KEGG   Shewanella violacea: SVI_4044Help
Entry
SVI_4044          CDS       T01206                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
svo  Shewanella violacea
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SVI_4044 (glpK)
Enzymes [BR:svo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SVI_4044 (glpK)
Exosome [BR:svo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SVI_4044 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4638761..4640254)
Genome map
AA seq 497 aa AA seqDB search
MTKKYVIALDQGTTSSRAIVFDHDANIVAMSQREFTQIYPQAGWVEHDPMEIWASQSSTL
IEVLARADIHSDEVAAIGITNQRETTVIWDKNTGKPVYNAIVWQCRRSSNICDELKSQGL
EEYVRESTGLLLDPYFSGTKIKWILDNVAGVRARAEKGELLFGTIDTWLVWKLTEGKVHV
TDPTNASRTLLFNIHTQQWDQKLLKALDIPSSLLPEVKPSTCIYGKTRIAGEGGEIDIAG
IAGDQQSALFGQLCIDEGMAKNTYGTGCFLLMNTGKQAVRSKHGLLTTIAIGAEGEVNYA
LEGAVFMGGATIQWLRDELGLIRDAQDTEYFASKVADTNGVYLVPAFVGLGAPYWQPNAR
GALVGLTRGSNRNHIIRAALEAIAYQSRDLLEAMTKDSGVMLKQLNVDGGAVANDFLMQF
QADISNVEVHRPVVTETTAMGAAFLAGLAVGFWQSTDELKHKANLDKSFSPGISPEARES
LYLGWKQAVSQVTSTNT
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagaaatatgtgattgcgttagaccaggggactacaagctcaagagctatcgta
tttgatcatgatgccaatattgttgccatgtctcagcgcgaatttacccaaatataccct
caagctggctgggtcgaacatgatcctatggaaatatgggcatcccaaagttcgaccctt
atcgaagtactcgccagagccgatattcacagtgatgaagtggcggccataggcataact
aatcagcgtgaaactacggttatatgggataaaaatacaggtaagccggtatataacgcc
attgtttggcaatgccgtcgcagcagtaatatctgtgacgagcttaagtcacagggctta
gaagaatatgtccgtgagtctaccgggcttctcttggatccctatttttcaggcactaaa
ataaaatggatattagataatgttgccggcgtgagagctcgggcggaaaagggggagctc
ctgtttggcactatcgatacctggctggtgtggaagctaaccgagggtaaggttcatgtc
acagatccgacgaatgcgagccgcaccttactctttaatattcatactcagcaatgggat
caaaagttactcaaagcactcgatatcccaagctccttgttacctgaggttaagccatct
acttgtatctatggcaagacacgaattgcaggggaaggtggagagatagatattgccggt
attgccggtgatcagcaatcggccctgtttggccagctttgtatcgatgaggggatggcc
aagaatacctatggtactggctgttttttgctgatgaacacaggcaaacaagcggtgcgg
tctaaacatggcctgttaaccacaattgccataggtgccgagggggaagtcaattatgcc
ctggagggagccgtttttatgggaggggcgacgattcaatggctcagagatgagcttggt
ctaattcgagatgcccaagataccgaatattttgcttctaaggtagcagatactaatggc
gtttatttagttccggcctttgttggtttaggtgctccttattggcagcctaatgcgcgt
ggtgcattagtcggtttaacacgaggctccaaccgcaatcacattatcagagccgcatta
gaagctattgcctatcagagtcgcgatcttctcgaggcgatgaccaaagacagtggagtc
atgttaaagcagttgaacgtcgatggtggtgcagttgctaatgactttttaatgcagttt
caggcagacataagcaacgtagaggtacatcgtccagtcgttaccgagactacggcaatg
ggggcagcctttttggcaggtctggctgttgggttttggcagtctacggatgaactgaaa
cataaagcaaacttagacaaatcttttagtccagggatttctccagaggcaagagagagt
ctttacctcggctggaaacaagcggtttctcaagtaacgtcaactaatacctga

DBGET integrated database retrieval system