KEGG   Shewanella violacea: SVI_4184Help
Entry
SVI_4184          CDS       T01206                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
svo  Shewanella violacea
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SVI_4184
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SVI_4184
Enzymes [BR:svo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SVI_4184
Lipid biosynthesis proteins [BR:svo01004]
 Desaturase
  First
   SVI_4184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4787860..4788984
Genome map
AA seq 374 aa AA seqDB search
MNWIRIMNKPPLIWTNVAFFLITFLGAAILVPLYGMTQGYGLTEWFAFIGFAFASGLSIT
AGYHRLWSHKTYKAKAPVRFMFALGGALALQNSALHWSSDHRVHHKHVDNNDKDPYSAKM
GFWYSHIGWMLREYQSQRYHDYKNVRDLQNDKIVMWQHKYYLPLVILMNIGLPAFLGWLN
GDILAMLLMAGLLRLVVVQHCTFFINSLAHVWGSQPYTDKNTARDNGFIALLTYGEGYHN
FHHIFENDYRNGIHWWHYDPTKWLINSLNWCGLAKDLRVTPQERIESAKLKMQLQRTQIR
VSTLSNCDEVLEKLQAEYEILKSHLADYYQAKKELLEAKRKQLANKHLVLQVDEMKQRFI
LQHKNWKLLTATYA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgaactggataagaataatgaataaacccccgctaatttggactaatgtagctttcttt
ttaatcaccttcctaggtgcagccatactcgttcccttgtatggcatgactcagggctat
ggtttgactgaatggtttgctttcattggttttgcttttgccagtggcctatccattacc
gcaggttatcaccgcctgtggtcgcacaagacctataaagccaaggctcctgtgcgcttc
atgtttgcacttggcggtgcattagcactacaaaatagcgctcttcactggtcttcagat
catagagtgcatcataaacatgtggataataatgataaagatccttattcagctaagatg
ggattctggtacagtcacataggctggatgttgagggaataccaatctcagcgttatcat
gattataagaatgttcgagatctgcagaatgacaagatagttatgtggcagcacaaatac
tatcttcctttagttattttgatgaacataggcttacccgcatttttaggctggctcaat
ggcgatattctagcaatgctacttatggctggtctgttaaggctggttgtcgtgcaacac
tgtaccttctttattaactctctcgcccatgtatggggcagtcagccatatacagataag
aacacagcgcgagataatggttttatcgctctgcttacctatggtgaaggctatcacaac
ttccatcacatcttcgagaacgactatcgtaacggcatacattggtggcactacgatcca
accaagtggctaatcaattcactcaattggtgtggactagctaaagatctgcgcgtcact
cctcaggagagaattgagagtgccaaactcaagatgcagttacagcgcacccaaattcgc
gtctcgacgctgagtaactgtgacgaggtattagagaagctacaggcagaatatgagata
ttaaaatctcatctggctgactactatcaagctaagaaagagctgctcgaggcgaaacgt
aaacagttagccaacaagcacttagtcctgcaagttgacgaaatgaaacaacgttttatt
ttacaacataaaaactggaagctactcacagcgacttacgcttag

DBGET integrated database retrieval system