KEGG   Staphylococcus warneri: A284_00365Help
Entry
A284_00365        CDS       T02449                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
swa  Staphylococcus warneri
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A284_00365
Enzymes [BR:swa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A284_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83636..84547
Genome map
AA seq 303 aa AA seqDB search
MTNKVVILGSTNVDQFLTVERYAKPGETLHVEEAQKSYGGGKGANQAIATARMKADTTFI
SKVGNDGLAQFMFEDFKAAGMNIDYILESETEKTGQAFITVDAQGQNTIYVYGGANMAMT
PDDVKSAKAAIVDADFIVAQLEVPVPAIIEAFKVARAAGVTTVLNPAPAKEIPQELLELI
DVIVPNEFEAEILSGVPVTDEKSMAQNADYFLSLGAKVVIITLGEQGTYYAVENDSGLVP
AQKVKAIDTTAAGDTFIGAFVSRFNMKERNLVEAIDFANKAASLTVQKSGAQASIPLAEE
VQL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaagtcgttattctaggatctaccaatgtggatcaatttttaacagttgag
cgctacgctaaaccaggggaaacattacatgtagaagaggcacaaaaatcatatggtggc
ggtaaaggggcaaaccaagccattgcaacggcacgtatgaaagctgatacgacattcatt
tccaaagtgggcaatgatggattagcacaatttatgtttgaagattttaaagcagcaggt
atgaacattgactatattttagaatctgaaacagaaaagactggccaagcctttattaca
gtggatgcacaaggtcaaaatacgatttatgtctatggtggtgcaaatatggcgatgaca
ccagacgatgtgaaaagtgcgaaagcagcaattgtcgatgcagatttcattgtggcacaa
ttagaagtaccagttccggcaattatagaagcatttaaagttgcgagagcggcaggtgtg
acgaccgtcttaaaccccgcaccagccaaagagattcctcaagagttattagaattaatc
gatgtgattgtaccaaatgaatttgaagctgaaatattatcaggtgtaccagtcacagat
gaaaaatcaatggcacaaaatgcagattacttcttaagcttaggtgccaaagtcgtgatt
attacattaggtgaacaaggcacatactatgcggttgaaaatgattccggcctagtacca
gcgcaaaaagtaaaagctattgatacaacagcagcaggcgatacgtttatcggtgccttt
gtcagtcgctttaatatgaaagaacgtaatttagttgaggctatcgactttgccaataaa
gccgcatcactaacagttcaaaagtcaggggcacaagcctctataccattagcagaagaa
gttcaattatag

DBGET integrated database retrieval system