KEGG   Staphylococcus warneri: A284_03870Help
Entry
A284_03870        CDS       T02449                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
swa  Staphylococcus warneri
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:swa00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812391..812990
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVIVFKPAIDDRYHKEKVVSHNG
NAIEAINISTAREILNHDLSHADVIGIDEVQFFDENIVSIIQQLADQGHRVIVAGLDMDF
KGEPFEPMPKLLALSEHVTKLQAVCAVCGGPSSRTQRLIDGQPAKADDPIILVGANESYE
PRCRAHHIVAPSENEKEEM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttatcattccggatggatagaatgtattaccggaagtatgtttagtggt
aaatcagaggaacttatacgtcgacttagacgagggatttatgctaaacagaaagttatt
gtttttaaaccagcaattgatgatcgctatcataaagaaaaggtagtttcacataatggc
aatgcaattgaagctataaatatttcaacagctagagaaattttaaatcatgacttatct
catgcagatgttatcggcattgatgaagttcaattttttgatgaaaatattgtaagtatc
atacaacaacttgctgatcaaggtcatcgtgtcattgtggctggattagatatggacttt
aaaggcgaaccgtttgagccaatgcctaaattattggctttaagtgagcatgttacaaaa
ttgcaagctgtatgtgcggtatgtggagggccttcaagtcgaacacaaagacttatcgat
ggtcaaccggctaaagcagatgatcctattattttagtaggtgctaatgaaagttatgaa
ccaagatgtagagcgcatcatattgtagcgccaagtgaaaatgagaaggaggaaatgtag

DBGET integrated database retrieval system