KEGG   Staphylococcus warneri: A284_04835Help
Entry
A284_04835        CDS       T02449                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
swa  Staphylococcus warneri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:swa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1009802..1011199
Genome map
AA seq 465 aa AA seqDB search
MSKNVAIIGAGITGLTSAYYMKKQNPHLNVTIYEATNRPGGKIQTYRKDGYTIELGPESY
LGRKTIMTDIANEIGLGNDLITNTTGQSYIYAKNKLYPIPGGSIMGIPTDIKPFIKTKLI
SPLGKLRAGLDLFKKPIEIEDDISVGDFFRQRLGDEVLENLIEPLMGGIYGTNIDDLSLM
STFPNFKEKEEAFGSLIKGMKDEKEQRIKQRQLYPGAPKGQFKQFKHGLSSFIEALEEAV
KNQGVDIQYNTKVEDIIVSQRDYQVVVDGKNEVYDGVLVTTPQQVFMQWFNHDPAFDYFN
TMDSTTVATVVLAFDEKDIENTYDGTGFVIARTSNTDITACTWTSKKWPFTTPEGKVLIR
AYVGKPGDTVVDDHTDEEIVSIVRRDLKQMMTFKGDPEFTIVNRLPKSMPQYHVGHIKQI
RKIQEHIKRTYPRLKITGAPFEAVGLPDCIQQGHNAVDEMLEELR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaagaatgtagcaatcatcggtgcaggtataaccggcttaacaagtgcttactat
atgaaaaaacaaaatcctcatttaaatgtaaccatttatgaggcaaccaatcgaccaggt
ggaaaaatccaaacataccgtaaagatggctatacgattgaattaggcccagagtcttat
ttaggtagaaaaacgattatgactgatatagctaatgaaattggattaggtaatgattta
attaccaatacgacaggtcaatcatacatttatgctaaaaataaattatatccgataccg
ggtggttctattatgggcataccaacggatattaaaccttttatcaaaactaaattaatt
tcaccattaggtaaacttagagctggattagatttatttaaaaagcctatcgagatagaa
gatgacatttcagtaggtgatttctttagacaacgtttaggtgatgaagttcttgagaat
ttaattgaaccactaatgggtggtatctatggtacaaatatagatgacttaagtttaatg
agtacatttcccaattttaaagaaaaagaagaagcctttggtagcttaattaaaggtatg
aaagatgaaaaagaacaacgtattaaacaacgtcaattatacccaggtgcgcctaaagga
caatttaaacagttcaagcatggtttaagctcatttatcgaagcacttgaagaagctgtt
aaaaatcaaggtgtagacattcaatataacactaaagttgaagatattattgtatctcaa
agagactatcaagtggttgttgatggtaaaaatgaagtatatgatggtgtattagtcact
acacctcaacaagtgtttatgcaatggttcaatcatgatccagcgtttgattatttcaat
acgatggattcaacaacagtggcaacagttgtcctagcatttgatgaaaaagatattgaa
aatacttatgatggtactggttttgtaattgctagaacaagtaatacagatattacggca
tgtacatggacatctaaaaaatggccatttacaacaccagaaggcaaagttttaataaga
gcttatgttggtaaaccaggtgatactgttgtggatgatcacacagatgaagaaattgtt
tctatagtacgtcgtgatttaaaacaaatgatgacatttaaaggtgatcctgaattcaca
atagtcaatcgattaccgaaaagtatgcctcaataccatgtaggtcacattaaacaaatt
agaaaaattcaagaacatattaaacgaacttatccgcgattaaaaattacaggggcgcca
tttgaagcggttggcctacctgattgtatccaacaaggtcataatgcggttgatgaaatg
ctagaggaattacgttaa

DBGET integrated database retrieval system