KEGG   Staphylococcus warneri: A284_05435Help
Entry
A284_05435        CDS       T02449                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
swa  Staphylococcus warneri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A284_05435
Enzymes [BR:swa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     A284_05435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157582..1158250
Genome map
AA seq 222 aa AA seqDB search
MKPVVVMTQTSEIQSDLVTIIHKPFIDIKPLEFDLRLLKDNYDWLIFSSKNAVKYFLPYL
YLVNYKKIAVVGVKTAQYCRELKIPVDLIPQDYSQEGLISEFQKYNQNILIPSSKQARPL
LKETLARNNDVVKIDLYEPVPHYQHINEVKSLIFNQEIDALTFSSSSSVRYYFNEDPIPK
FDHYFAIGKQTANTIHSYNQPVIVADKQTLEALIDKVVESRD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagttgtagttatgacacaaacaagtgaaattcaaagtgatttggttacaatt
attcacaaaccatttatagatataaaaccacttgaatttgatttgcgtttgttaaaagat
aactatgactggcttattttttcgtctaaaaatgcagttaaatattttttgccttatcta
tatttggtaaattacaaaaaaatcgcagttgttggtgtaaaaactgctcaatattgtcgt
gaattaaaaatccctgtagatttaattccacaggattactcacaagaaggattaattagt
gaatttcaaaaatataatcaaaatatcctcataccttctagtaaacaagcacgtccatta
ttaaaagaaacattagctcgaaataatgatgttgttaaaattgatttgtacgagccagta
ccacattatcaacatataaatgaagttaaatcattaatttttaatcaagaaattgatgct
ttaacattttcaagttcatcttcagtacgttattattttaatgaagacccaatacctaag
tttgatcactattttgcaattggcaagcaaacggcaaatacgatacattcatataatcaa
ccagtcattgttgcagataaacaaactttagaggcattgatagataaagtagtagaaagt
agggactaa

DBGET integrated database retrieval system