KEGG   Staphylococcus warneri: A284_06510Help
Entry
A284_06510        CDS       T02449                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
swa  Staphylococcus warneri
Pathway
swa00670  One carbon pool by folate
swa00790  Folate biosynthesis
swa01100  Metabolic pathways
Module
swa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A284_06510
   00670 One carbon pool by folate
    A284_06510
Enzymes [BR:swa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A284_06510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AGC90619
UniProt: L7WW75
Position
1395105..1395587
Genome map
AA seq 160 aa AA seqDB search
MTLSILVAHDQQRVIGYQNQLPWHLPNDLKHVKELTTGHTLVMGRKTYESIGKPLPNRRN
VVLTKNMSFHPDGVDVIHSFEEIQQLEGHVFIFGGQTLFEEMIDKVDDMFITVVDGKFQG
DTFFPPYTFEEWEVESSVEGKLDEKSTIPHTFLHLKRKKS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacattatctattttagtcgcacatgatcaacaaagagttataggttaccaaaatcaa
ttaccatggcatttacctaacgaccttaaacatgttaaagaattaacaacaggtcatacg
ttagtaatgggacgaaaaacttacgaatccattggtaaaccattaccaaatagacgaaat
gtggttttgactaaaaatatgtcttttcatcctgatggtgtggatgtcattcattctttc
gaagagattcaacaattagaaggccacgtatttatttttggtggtcaaacattatttgaa
gaaatgatagataaagtagacgatatgtttattactgtggtagatggaaaatttcaaggt
gatacattctttcctccttacacttttgaagaatgggaagttgagtcatcagttgaaggc
aaactagatgaaaaaagtacaattccacatacatttttacatttaaaaaggaaaaagtca
tag

DBGET integrated database retrieval system