KEGG   Staphylococcus warneri: A284_06510Help
Entry
A284_06510        CDS       T02449                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
swa  Staphylococcus warneri
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A284_06510
   00670 One carbon pool by folate
    A284_06510
Enzymes [BR:swa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A284_06510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395105..1395587
Genome map
AA seq 160 aa AA seqDB search
MTLSILVAHDQQRVIGYQNQLPWHLPNDLKHVKELTTGHTLVMGRKTYESIGKPLPNRRN
VVLTKNMSFHPDGVDVIHSFEEIQQLEGHVFIFGGQTLFEEMIDKVDDMFITVVDGKFQG
DTFFPPYTFEEWEVESSVEGKLDEKSTIPHTFLHLKRKKS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacattatctattttagtcgcacatgatcaacaaagagttataggttaccaaaatcaa
ttaccatggcatttacctaacgaccttaaacatgttaaagaattaacaacaggtcatacg
ttagtaatgggacgaaaaacttacgaatccattggtaaaccattaccaaatagacgaaat
gtggttttgactaaaaatatgtcttttcatcctgatggtgtggatgtcattcattctttc
gaagagattcaacaattagaaggccacgtatttatttttggtggtcaaacattatttgaa
gaaatgatagataaagtagacgatatgtttattactgtggtagatggaaaatttcaaggt
gatacattctttcctccttacacttttgaagaatgggaagttgagtcatcagttgaaggc
aaactagatgaaaaaagtacaattccacatacatttttacatttaaaaaggaaaaagtca
tag

DBGET integrated database retrieval system