KEGG   Staphylococcus warneri: A284_06785Help
Entry
A284_06785        CDS       T02449                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
swa  Staphylococcus warneri
Pathway
swa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
swa01100  Metabolic pathways
swa01110  Biosynthesis of secondary metabolites
swa01130  Biosynthesis of antibiotics
swa01230  Biosynthesis of amino acids
Module
swa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A284_06785 (trpC)
Enzymes [BR:swa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     A284_06785 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE
Motif
Other DBs
NCBI-ProteinID: AGC90674
UniProt: L7WWB4
Position
complement(1450919..1451719)
Genome map
AA seq 266 aa AA seqDB search
MTILDEIVLYKKELLSSHYYHEKLKTLKNNNQYNQPSKKKTLKSSLANDKELSIIAEIKS
KSPSVKQLPERNLSQQIKDYEAYGANAISILTDERYFGGSFERLQQLSKQTSLPVLCKDF
MIDEIQVDVAKTAGASIILLIVNILTDEQLHRLYQYACQLDLEVLVEVHDSQELQRAYEL
NPEIIGVNNRDLKRFVTDVEHTNQILGHKKDGFYYISESGIHSQKDVAKIIHSGIDGLLI
GEALMKCDDLSEFLPQLKLNKVKPCI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacaatattagacgaaattgtactatataaaaaagaattattatctagtcattattat
catgaaaaacttaaaactttaaaaaataataatcaatataatcaaccatctaaaaagaaa
actttgaaatcaagcttagcaaatgacaaagaattatctatcattgcagaaattaaatcg
aaaagtccatctgtaaagcaactacctgaacgtaatttgtcgcaacaaattaaagattat
gaagcttatggagcaaatgccatatctatcttaacggatgaacgttatttcggtggtagt
tttgaacgcttacaacaattatctaaacaaacgtcgctacccgtattatgcaaagacttt
atgatagatgaaatccaagttgatgtagctaaaacagcaggtgcatcaattattttactc
atagtaaatattttaactgatgaacagctccatcgtttatatcaatatgcctgtcaatta
gatttagaagtattagtagaagtccatgatagtcaagaattgcaaagagcttacgagctt
aatccagaaattataggtgttaataatagagacttaaaacgatttgtgacagatgtagaa
cacaccaatcagatattaggtcataaaaaagatggtttttactatatttccgaaagtggt
attcactctcaaaaagatgtagcaaaaataattcattctggtatcgatggattacttatt
ggtgaagcgttaatgaaatgcgacgatttaagtgaatttttaccacaattaaagttaaat
aaggtgaaaccatgtatttaa

DBGET integrated database retrieval system