KEGG   Staphylococcus warneri: A284_06985Help
Entry
A284_06985        CDS       T02449                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
swa  Staphylococcus warneri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:swa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A284_06985
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A284_06985
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A284_06985
Enzymes [BR:swa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A284_06985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1497740..1498801)
Genome map
AA seq 353 aa AA seqDB search
MKRWQGLVKEFESYLPVNDQTPKLTLNEGNTPLIYCENMSEMLGIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKVVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKNGDIELVNSVNPFRIEGQKTGAFELVEQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHEKKGSQLPQLFGFQAEGASPIVQNKVIKNPETVATA
IRIGNPASWEKATNALKESNGLIDSVTDEEILEAYQMMTSKEGVFSEPASNASIAGLIKL
KRAGRLPQGKKVVAVLTGNGLKDPDTAISLLDNPIQPLPNDKESIIKYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggtttagttaaagaatttgaatcatatttacctgtaaatgaccaa
acacctaaattaacgttgaatgaagggaatacaccgttaatttattgtgaaaatatgtca
gaaatgcttggaatcgaactatacgtaaaatatgaaggtgcgaatccaacaggttctttt
aaagatagaggcatggttatggccgtaactaaagcaaaagagcagggtaaaaaagttgtt
atttgtgcgtcaacaggaaatacatcagcatcagcagcggcatatgcagctagagcaggg
ttgaaagcaatagtagtcattcctgaagggaaaatagctttaggtaaattatcgcaagca
gtaatgtatggtgctgaaatcgtatccattgaaggaaactttgatgaagctttagaaatt
gtgaaagagattgcaaagaatggcgacattgaattggtgaattcggttaatccatttaga
attgaagggcagaaaacaggcgcttttgagttagtagaacaactagatggtgaagctcca
gatattttggcgattccagttggtaatgcaggtaacataactgcatattggaaaggtttc
aaagaatatcatgagaaaaaaggtagtcaattaccacaattatttggtttccaagcagaa
ggtgcatcaccaatcgttcaaaataaagtcattaaaaatccagaaactgttgctactgct
attcgtattggaaatcctgcgagttgggagaaagcgactaatgcacttaaagaatcaaat
ggattaattgatagtgtaactgatgaagaaattttagaagcttatcaaatgatgacatct
aaggaaggggttttcagtgagcccgctagtaatgcatctattgcaggtttaattaaatta
aaacgtgctggtcgcttaccacaaggaaaaaaagtagtagctgttttaacaggaaacggt
ttgaaagacccagacacagctatttctttattagataatccaatacaaccacttcctaat
gacaaagaaagcattattaagtatattaaaggagctttataa

DBGET integrated database retrieval system