KEGG   Staphylococcus warneri: A284_11120Help
Entry
A284_11120        CDS       T02449                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
swa  Staphylococcus warneri
Brite
Enzymes [BR:swa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     A284_11120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2356570..2357304)
Genome map
AA seq 244 aa AA seqDB search
MMNIKSPSPLYLKGTSQQAILLLHSFTGTVKDVKHLATTLHEQGFTCYVPNYPGHGLPVT
QFIKYDVNDWWACVQEAYQFLKEEGYEVINAAGVSLGGLFTLRLAENVELNRIVVMSAPS
EKTEAGIAWRLEKYGKRMNQIMRLSEDESVESLAQINQYQDEIKVFQGVINDIMSNLHDI
KSTARILYGGQDEAAYEESAHYIFNQISSDNKSIQDFPLNQHLMTHGEGRDALEQDIVEF
FTQK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattaaatcaccaagtccactttatttaaaagggacaagtcaacaagctata
ctattattacattcattcacaggtactgttaaagacgtgaagcaccttgctacaacgctg
catgaacaaggattcacgtgttatgtacctaactatcctggtcatggattaccggttaca
cagtttattaagtatgatgttaacgattggtgggcatgtgtgcaagaagcgtatcagttt
ttaaaggaagaagggtacgaagtcattaatgcagccggtgtatcgttaggtggattattt
acattacgattagctgaaaatgttgaattaaatcgtatcgtagtgatgtctgcacctagc
gagaaaacagaagctggtattgcttggcgcttagaaaaatatggcaaacgcatgaatcag
ataatgagactgtctgaggatgagagtgttgaatcattagcccaaatcaatcaatatcaa
gatgaaattaaagtatttcaaggtgttattaatgatattatgtcaaatttacatgatatt
aaatcgactgctagaattttgtatggtggacaagatgaagcggcttatgaggaaagtgcg
cactatatttttaatcaaattagtagcgataataaatcaattcaagattttccactaaat
caacatttaatgacccacggtgaaggaagagatgcattagaacaagatatcgttgagttt
ttcactcaaaaataa

DBGET integrated database retrieval system