KEGG   Shewanella woodyi ATCC 51908: Swoo_0051Help
Entry
Swoo_0051         CDS       T00676                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:swd00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(61551..62552)
Genome map
AA seq 333 aa AA seqDB search
MSLALDQQTHAQPQAADNTFSSEHALNTAEQQAFWQTVTQSVIKTSDNINLAYAYVAHPG
STKAIVISNGRVESYLKYQELIFDLYQQGYSIYAIDHRGQGLSSRTTANTHQGHIDRFDT
YVEDFALFIDEIVTPNQHQELFLVGHSMGGAIGTLYLNKHPQTFKAAVFSAPMYGIKLPI
SRRFIRWLAKQLDTSSPNKEPNYILGGKDYDPVAFAKNDLTHSQLRYENYRTLYEIHPEL
KLGSPTNHWLFESIDAGEKTVEAAKNSDTPILILQADEDTIVDNFAQYHAVSDRCMLINI
PNARHELFMERDESRNLTLTELINFFDKYSAKP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtctctagccctagatcaacaaacacacgctcaacctcaagctgctgataacactttt
tcatcggagcacgcactcaacacagctgagcagcaagcattttggcaaacagtcacccaa
tcggtcatcaaaacctctgacaatatcaacttagcttatgcttatgtagcacatccaggt
agcaccaaggctatcgtgatcagtaatggtagagttgaatcttatttaaaataccaagag
ctgatatttgatctttatcagcagggctatagcatttacgccatcgatcatcgtggccaa
ggcctttcaagtagaaccacagccaacacacaccaaggccatatagacagatttgatacc
tatgtcgaagacttcgccctctttatcgacgaaatagtgacaccaaatcagcatcaggag
ctgtttctagttggccactctatgggtggggccataggtactctttatctgaataaacac
ccacaaacattcaaggcggctgttttttcagcccccatgtatggcattaaactgcctatt
agtcgccgctttatccgctggttggctaaacagctagatactagctcgcccaacaaagag
cccaactatattttgggtggtaaagattacgaccctgtagcttttgccaaaaatgatctt
acccatagtcagttgcgttacgaaaattaccgcacactctatgagatccacccagagtta
aagctcgggtcaccaaccaaccactggttatttgaatcaattgatgcaggggaaaagacg
gttgaagcggctaaaaacagtgatacgcccatcttaatccttcaggctgatgaagatact
attgtcgataacttcgcccagtaccacgccgtcagtgaccgctgtatgcttatcaatatc
cctaatgctcgtcatgagctctttatggagcgagatgagagcagaaacttgacgcttaca
gagctaattaacttctttgataagtattctgcgaagccgtaa

DBGET integrated database retrieval system