KEGG   Shewanella woodyi ATCC 51908: Swoo_0482Help
Entry
Swoo_0482         CDS       T00676                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:swd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(669164..669895)
Genome map
AA seq 243 aa AA seqDB search
MKLLLTRPKGRNQSMSEALTQLGVPYIITPLLEVQASKTHQDQDAIAHFNAADIIIFIST
NAVEFSSQVIELKKHKTAQFYAVGDATFQALKALGIDAFAAPSDCQQTEGLLTLADLQEL
TGQNIMIVRGVGGRETLAEKLTQRGAKVNYWETYQRACPAINERTPYLWHDEKVDTIIIT
SGEILHSLIKLVPKELFAWLRACHIIVPSSRVKEQALAYGLEHVTNAKAANSKAMLSALG
LSI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattactgacgcggccaaaaggccgcaatcagtcgatgtcagaggccctaact
caacttggggtcccttacatcattacgcctttactggaagttcaggcaagtaaaactcac
caagaccaagatgctattgctcattttaatgccgccgatatcatcatctttatcagcacc
aatgccgttgagttctcttcacaagttattgagctaaaaaaacacaagacagctcaattt
tatgccgtaggtgacgccactttccaagctttaaaggcattaggcatagacgcatttgca
gcaccatctgattgccagcaaaccgaaggtttattgacccttgccgatctacaagagctt
accggtcaaaatatcatgattgtcagaggagttggtgggcgagaaacattggctgagaaa
ctgacccaacgtggagcaaaggttaattactgggaaacataccaaagagcttgcccagcc
attaatgaacgtactccctatctatggcacgatgaaaaagttgatacgattatcatcacc
agtggagaaattctccatagcctaatcaaacttgtaccaaaagagttatttgcttggctg
cgtgcatgtcatattatagtccctagctcccgagttaaggagcaagctttagcttatgga
ctcgaacacgttaccaacgccaaagctgcaaatagtaaggccatgctttccgccctaggc
ttatccatttag

DBGET integrated database retrieval system