KEGG   Shewanella woodyi: Swoo_0540Help
Entry
Swoo_0540         CDS       T00676                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
swd  Shewanella woodyi
Brite
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Swoo_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
762774..764273
Genome map
AA seq 499 aa AA seqDB search
MRSKSLLLVLSTSLLLSACSDSDSQDETALEQEVVTKELRGEIRLASLSGDPSLNRSVPE
ASSPLAVLGMQLFYSQALSGDMDTACVSCHHPKLGGGDNLALSIGVEAADPLLLGPGREH
SSAGHDYDGGPTVPRNAPTTFNIALWDRAIFHDGRLESIEGTENMNGEGTNMVSPDSPDR
ATPDESAANLTVMQAMFPVTSSEEMKGHHFQEYDNQEIRQYLVERLRGETGELVTNEWLA
AFQLGLQDPDGTAESLITQTNIFTAIGEFERSQVFVNSPWKSFVQGDDDAISLNSKKGAL
IFFKPQEQGGANCASCHKGDFFTDEEYHNIAMVQVGRGKGDGESGSNDFGRFKVTQLERD
KFAFRTPSLLNITQMGPYGHAGSYHSLEAVVRHHLDVNDAINNYDADANIEQQGVQTQNM
MSNTLAALNKLNAERNAGTEGVLQDRALSDEEFDQLISFLHTLTDSCIADADNTQCLAPW
IPGDDIADPDGLRLEAVIR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaaaaagtttactgcttgtactaagtacaagcttattattgagcgcttgttca
gatagcgacagtcaagatgaaacagcactagaacaagaggttgtgactaaggagctaaga
ggggagattaggcttgcgtcactcagtggtgatcccagtttgaataggagtgtgcccgaa
gcaagtagtcctcttgcagtgttggggatgcaactcttttacagtcaggcattgagtggt
gatatggataccgcctgtgttagctgccatcacccaaaactcggaggtggtgataattta
gcgctttcaattggtgtcgaagctgccgaccctctgttacttggcccaggtcgcgaacat
agttcagcgggacatgattatgacggtggcccaacggtgccaagaaatgcgcctacaacc
tttaatattgccctgtgggatagggcgatatttcatgatggtcgactcgagagtatagag
ggcactgaaaatatgaacggtgaaggcaccaatatggtgtcaccggactctccagaccga
gccacgcctgatgagagtgcggccaatctaaccgtgatgcaagccatgttccctgtgacc
tcgagtgaagagatgaagggccatcattttcaagagtatgataatcaagagatccgccaa
tatctcgttgagcgtttgcgcggagagacaggcgagctagtgacgaatgagtggttagct
gcatttcagttagggttacaagatcccgatggaaccgccgaaagccttattacccaaact
aatatatttacagccattggtgaatttgagcgttctcaagtatttgttaatagcccctgg
aagtcatttgttcagggagatgatgatgccatctctcttaatagtaaaaagggagccctg
atattttttaaaccacaagagcaggggggagcaaattgtgcgagttgccataaaggagat
tttttcaccgacgaggagtatcacaatatcgccatggtgcaagttggccgtggtaaaggg
gatggagagagtgggagcaatgattttggccgttttaaggtaactcaacttgaacgtgat
aagtttgcctttcgaaccccaagtttattaaatataacccaaatgggcccctatggtcat
gcggggagttatcattccttggaagccgtagtcaggcaccaccttgatgttaatgatgcc
atcaataactatgacgctgatgcgaatattgagcagcagggcgtgcaaactcaaaatatg
atgagcaataccttagccgcgctgaataagcttaatgccgagcgcaatgcaggcactgag
ggagtgttgcaagatagggcgcttagcgatgaagagttcgatcaactaatctcatttctg
cacactttaaccgacagctgtattgccgatgcagataatactcaatgtttagccccttgg
atccctggtgatgatattgccgatcctgatgggctgagattagaagctgtcataaggtag

DBGET integrated database retrieval system