KEGG   Shewanella woodyi: Swoo_0562Help
Entry
Swoo_0562         CDS       T00676                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
swd  Shewanella woodyi
Pathway
swd00010  Glycolysis / Gluconeogenesis
swd00052  Galactose metabolism
swd00500  Starch and sucrose metabolism
swd00520  Amino sugar and nucleotide sugar metabolism
swd00521  Streptomycin biosynthesis
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
swd01200  Carbon metabolism
Module
swd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swoo_0562
   00052 Galactose metabolism
    Swoo_0562
   00500 Starch and sucrose metabolism
    Swoo_0562
   00520 Amino sugar and nucleotide sugar metabolism
    Swoo_0562
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Swoo_0562
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Swoo_0562
Enzymes [BR:swd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Swoo_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACA84858
UniProt: B1KR41
Position
complement(791910..792848)
Genome map
AA seq 312 aa AA seqDB search
MSFPSLVTLDIGGTKINAGRYVNGVIEDSRSFKFCANASLSEIECFIINCIDGFLIQSTT
AICIGVPCIVDTQLGVVYDAVNIPAWKEFDLKSALQRRYHLDVYINNDVNCFTAGEHRFG
AGQGYDDIIGLCLGTGVGAGYIINNELYQGHNCSAGEIGEVCYLTSTIDEYCSGRFFDLH
IGASGTDLAVKARSGEAYAIEAYSQFGRHLAHAISHLLLILDPQVIVIGGSVAHSFDLFK
EELWLGLADFPYNKVIENLKIIPSSNRDTALLGAAQLYLNQCKQNKKTEVTAQIVNSREV
SAESYLTSPQPS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagttttccttcacttgtcacccttgatattggtggcaccaaaatcaatgcaggccgt
tatgttaacggtgtaatagaggattcacgatcattcaagttttgcgctaatgcaagtttg
agtgaaattgagtgttttattattaactgcattgatggttttttaattcaaagtacaacc
gctatctgcattggtgtaccttgtattgtcgatactcagctaggggtggtttatgacgcc
gttaatatacccgcatggaaagagtttgatctcaaaagtgcgcttcagcggcgttatcat
ttagatgtctatatcaataatgacgttaactgtttcaccgcaggcgaacatagattcggt
gcagggcaaggttatgatgacatcataggtttatgccttggcacaggtgtaggcgcagga
tatattattaataatgagctttatcaaggtcataactgtagcgcaggcgaaattggagag
gtctgttatctcacttcgactattgatgaatactgctcagggcgcttcttcgatctacat
ataggagcttcaggcactgatctggcagtaaaggcaaggtcaggtgaagcttacgctatt
gaagcctactctcaatttggtcgtcacttagctcacgctatcagccatctactgcttatt
cttgaccctcaggtgatcgtgattggcggttctgtcgctcactcattcgatctctttaaa
gaggagctatggctagggcttgcagattttccctataacaaggtaatcgaaaaccttaaa
ataatcccatcgtccaatagagatacagccctgttaggtgcagcccaactttaccttaat
caatgtaaacagaataaaaaaacagaggtcacagcccaaatagttaactctagagaggtc
tcagctgagtcatacctaacatcacctcaaccctcttaa

DBGET integrated database retrieval system