KEGG   Shewanella woodyi: Swoo_0896Help
Entry
Swoo_0896         CDS       T00676                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
swd  Shewanella woodyi
Brite
Enzymes [BR:swd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Swoo_0896
Secretion system [BR:swd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Swoo_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1194512..1195240
Genome map
AA seq 242 aa AA seqDB search
MIFTRVCTLIFAVLLAQSAIAAPNTPTDDSKALKEKLADTLSVKVHSLQESPIPGLYEAL
TDRGVLYISKDGSKLFHGNLYDLDKGMKNLTEAAMAGPRIEMMKPLEDNMLVYKAKNEKH
VVTVFTDTTCGYCRKLHNEMQEYNDLGITIRYLAFPRRGIPSANADEMESIWCAADPLQA
MTDAKGGKSVKQEKCDAKIAEQYNLGQSFGVNGTPAIVLEDGSMIPGYQPPAALLKVLEA
TN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatttttacccgagtatgcaccctgatttttgctgtattgttggctcaatctgcgatt
gctgcccccaatacaccgacagacgatagcaaggctttaaaagagaagctagctgatacg
ttaagtgtaaaagttcactctcttcaggagtctccaatccctggtttatatgaagcatta
accgatcgcggtgtgctttatatctccaaagatggctctaaactgtttcacggtaatctt
tacgatctcgataaagggatgaagaacctgactgaggcggcgatggcgggccctcgaatt
gagatgatgaagcctcttgaagataatatgttggtctacaaggctaaaaacgagaagcac
gtggttacagtgttcaccgataccacctgtggttactgccgtaagctacataacgagatg
caggagtataatgatctaggtattactattcgttatctcgctttccctcgtcgtggcata
ccttcggcaaatgccgatgagatggaatcaatatggtgtgctgccgatccacttcaagcc
atgacagatgcaaaaggcggtaagagcgtcaaacaggagaagtgcgatgcgaaaattgcg
gagcagtacaacctaggccaaagctttggtgttaatggtacccctgcaattgtgctagaa
gatggcagcatgatccctggctaccaaccaccagctgcactgcttaaagtgcttgaagcg
actaactaa

DBGET integrated database retrieval system