KEGG   Shewanella woodyi: Swoo_1060Help
Entry
Swoo_1060         CDS       T00676                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
swd  Shewanella woodyi
Pathway
swd00230  Purine metabolism
swd00240  Pyrimidine metabolism
swd01100  Metabolic pathways
swd03030  DNA replication
swd03430  Mismatch repair
swd03440  Homologous recombination
Module
swd_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Swoo_1060
   00240 Pyrimidine metabolism
    Swoo_1060
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Swoo_1060
   03430 Mismatch repair
    Swoo_1060
   03440 Homologous recombination
    Swoo_1060
Enzymes [BR:swd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Swoo_1060
DNA replication proteins [BR:swd03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Swoo_1060
DNA repair and recombination proteins [BR:swd03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Swoo_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi DUF2883
Motif
Other DBs
NCBI-ProteinID: ACA85353
UniProt: B1KGM5
Position
complement(1377732..1378202)
Genome map
AA seq 156 aa AA seqDB search
MTQTLFYLMPTEPRSSGTALEQMFHLACELAQQAFIKQQLVYFHCQDREQAYAIDELLWQ
FEPRSFVPHNLKGEGPTTGAPVEIGFDNLGPNKNRHLLINLADQVPSFAVNFGQIIDFVA
NDTGHKAIARERYRQYRSLGVTLNTQDLAKQPLNLV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaaccctattttatcttatgccaacagagcctcgcagctcgggaacggcattg
gagcagatgtttcatctggcttgtgaactggctcagcaggcatttatcaagcagcagttg
gtctattttcattgtcaggatagagaacaggcttacgccatcgatgaacttttatggcag
tttgaaccacgctctttcgttccccataacttaaaaggggaaggaccgacaaccggagct
ccggttgagataggttttgataacctcggccccaataaaaatcgccaccttctgattaat
cttgcagaccaagtaccctcatttgcggtaaactttggccagattatcgatttcgttgcc
aacgatactggacataaagcgatcgcccgcgagcgctataggcagtatcgaagcttgggt
gttacattaaacactcaggatttagcaaaacaaccacttaatttagtttga

DBGET integrated database retrieval system