KEGG   Shewanella woodyi: Swoo_1272Help
Entry
Swoo_1272         CDS       T00676                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
swd  Shewanella woodyi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Swoo_1272
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swoo_1272
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Swoo_1272
Enzymes [BR:swd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Swoo_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1612350..1613630
Genome map
AA seq 426 aa AA seqDB search
MELYNLKHPSQVVNFAQALTLGLGKDRGLFFPKSIPVLEDMDSLLALPFVERSKKVLGAW
LASEIGQERVDSLVEKAFNFDLKLAKADEHRYCLELFHGPTLAFKDFGARFMAQCLNELA
GDDKINILTATSGDTGAAVADAFFGLDKIQVVVLYPKGKISVLQEKMFTTLGDNIHTVSV
ESDFDACQDLVKRAFEDSDVRDGLHLNSANSINISRLLAQICYYFEAVAQFKREHKQDPV
IAVPSGNFGNLTAGLFAKAMGLPVARFVAATNSNDTVPRYLDKGDWLPHATVATMSNAMD
VSEPSNWPRVEAVVEKMGWSLADITGVALSEQDTSKALSELNRQGYLCEPHAAIAAQALS
LTQSDGERGIFLGTAHPAKFKDVVDRELEVNLPLPQELAAVEKKDILSVTLPADFGQLKQ
HLFKIL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtataacttaaaacacccctcacaagtggttaattttgcccaagcgctcacg
ttaggcctaggtaaagacagaggcttgttttttcctaaatctattcctgtattagaggat
atggactcgctattggcactgccgtttgtcgagcgtagcaaaaaggtattaggtgcttgg
ctcgccagtgagatagggcaggagagagttgactccctcgttgagaaagcttttaacttc
gaccttaaactggctaaagctgatgagcatcgttactgcctagagctgtttcatggccct
accttagcctttaaagattttggagcccgctttatggcccagtgtctgaatgagcttgcg
ggtgatgacaaaattaatatattgacggccacctccggtgatactggcgctgctgttgca
gatgctttctttgggctggataagatccaagttgtggtgttataccctaaaggtaagata
agtgttcttcaggagaagatgtttaccacgctaggggacaatattcacactgtgtcggtt
gagtcagattttgatgcttgtcaggacttagttaagcgagcatttgaagacagtgatgta
cgtgatggtttgcacttaaactctgcaaattcaattaacatcagccgtttgctagcgcag
atctgttactactttgaagcagttgctcagtttaagcgcgagcacaagcaagatcctgtc
atcgcggttccaagtggtaattttggtaacctaactgcgggcttatttgctaaggcgatg
gggttacctgtagcaagatttgttgctgcaaccaatagtaacgataccgtgcctcgctat
cttgataagggggactggttgccacatgctacggttgccactatgtctaatgcaatggat
gtatctgagccaagtaactggccaagggttgaggcggtagttgagaagatggggtggtcg
ctagccgacattactggtgttgctttatcggagcaggatacttcaaaggcgctgagtgag
ctgaatcgtcaaggttacctctgtgagccccatgctgccattgctgcacaggcgctgagt
ctaactcagtctgatggcgagagggggatattcttagggacagcgcatcctgctaagttt
aaggatgtggtcgatagagagcttgaggtcaatctacctctacctcaagaacttgcagcg
gtggagaagaaggatatcttgtctgtcacattgcctgcagattttgggcaactcaaacaa
caccttttcaagattctctag

DBGET integrated database retrieval system