KEGG   Shewanella woodyi: Swoo_1322Help
Entry
Swoo_1322         CDS       T00676                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
swd  Shewanella woodyi
Pathway
swd00220  Arginine biosynthesis
swd00250  Alanine, aspartate and glutamate metabolism
swd00471  D-Glutamine and D-glutamate metabolism
swd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Swoo_1322
   00220 Arginine biosynthesis
    Swoo_1322
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Swoo_1322
Enzymes [BR:swd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Swoo_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACA85614
UniProt: B1KIW6
Position
1674185..1675099
Genome map
AA seq 304 aa AA seqDB search
MPEQALLEQVVDKVRPLLGQGKVADYIPALASVNPKKLGIAVTTIDGTTIGAGDYLEPFS
IQSISKVFSLTLALTLYEEHEIWSRVGKEPSGQSFNSLVQVELERGVPRNPFINAGALII
ADLIQSRLGAPKHRMLEIVRELSGNPSILYDKVVAASEYEHSARNAAIAYLMKSFGNFNN
DVDTVLHSYFHYCAMRMNCADLSKAMLYLANRGKSLSGQQLISPVQTRQMNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGDMSVCVWSPELDLNGNSLAGTAALEEFCQRLG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcaggcattactggaacaggtggtcgataaagttcggccacttttaggtcag
gggaaggttgcagattatattcccgcactggcaagcgttaatcctaaaaaactcgggatc
gctgtcaccacaatagatggtacaactataggggcgggggattaccttgagcctttctcg
attcagagtatctcaaaagtatttagccttaccttagctctcactctttatgaggagcac
gagatctggtcaagggttggaaaagaaccctctggtcagtcatttaattcgttagtccag
gtagagttggagaggggagtcccaagaaacccctttatcaatgctggtgcattaatcatc
gcggatcttattcagtctaggctaggtgctcctaagcatagaatgcttgaaattgtgcgg
gagttaagtggtaaccccagcatcctctatgacaaagttgttgcggcttctgagtatgag
cacagtgctcgaaatgctgccatcgcttatctgatgaaatcatttggtaatttcaacaac
gatgtggataccgttcttcatagttactttcactattgtgcaatgcgaatgaactgtgca
gatctttcaaaagccatgttgtacctcgctaatagaggtaagagtttgagtggtcagcaa
ctgatctcaccagtgcagactcggcagatgaatgcgctactggcaacctcaggcctttat
gatggggctggtgagtttgcttaccgtgtaggtatgccaggcaagagtggtgttggcggt
ggcattattgctgtgatcccaggtgatatgtctgtgtgtgtttggtcacctgagcttgat
cttaatggtaactcattggcgggaaccgctgcattggaagagttttgtcaacgattagga
cgttcaatcttttaa

DBGET integrated database retrieval system