KEGG   Shewanella woodyi ATCC 51908: Swoo_1349Help
Entry
Swoo_1349         CDS       T00676                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:swd00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:swd00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:swd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1698081..1699712)
Genome map
AA seq 543 aa AA seqDB search
MNKKLLVLSLAAILGLAACGSDGDNGANGNNGTDGNDGSNGTDGKDWSSVNEWYIDGQRR
VTKAAGFSVNNEAGAAKNIILFVGDGMGVSTVTAARILEGQLKGETGEENSLSFETLPHL
GLAKTYNVDGQTPDSAGTMTAMVTGVKTDVGVLSQAEGVTRGNCASTTNQNLVTSLELAA
MAGLSTGVVSTARITHATPAATYAHSPERNWESDADLPAEAVTNGCRDIASQLLDFDFGS
GINVVMGGGRRAFIPNTLTDAEGKNGKRLDGRNLTDEWTAKYTNSAYVEDRDSFLAINPA
TTDHALGLFNSSHMEYDYDRTIQGVTGEPSLAEMTAKSIDILKKNDKGFVLIVEAGRIDH
AHHAGNAARALYDTIALSEAVRVAMEKTSTKDTLLMVTADHSHVFTIAGYPTRGNPILGL
VKGNDSSGLPGPTNATDNNGLPYTTVGYTNGRGYANLSTGGDERYGYPVETGRVDLNYID
TQSAGFHQEALVPLSSETHAGEDVGIFASGPGSHLIEGTVEQNHIFHVINHAANLVVKAE
AAQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaactactggtactgtctttggcagcaatcttaggtctagctgcatgtggc
agcgatggtgataacggtgctaatggtaacaatggcaccgacggaaacgatggcagcaat
ggaactgatggtaaagactggagctctgtcaatgagtggtacattgacggccaacgccga
gtgactaaagcggcgggattttcagtcaacaacgaagcaggagctgccaaaaacatcata
ctgtttgtcggtgacggcatgggcgtatcaacggtaacagccgcgcgcattctcgaaggg
caacttaaaggagaaactggcgaggagaactcactctcatttgaaactctgcctcatctt
ggtttagccaaaacctataacgtagatggacaaactccagactcagccggcaccatgacg
gccatggtcacaggggttaaaaccgatgtcggcgtactgtcccaagctgagggagttacc
cgaggtaactgcgcgtcaaccacaaatcaaaacctagtgacctcccttgaattagccgca
atggcaggtttatctacgggggtagtgtctactgcacgtattacccatgcaacgcctgca
gctacttacgcccactcacctgaacgtaactgggagagtgatgcagacttgcccgctgaa
gcggtaaccaatggctgtagagatatcgccagccagttactcgacttcgattttggcagt
ggcatcaatgtggtaatgggtggcggacgccgcgcctttattccaaacaccttaaccgat
gctgaggggaagaatggcaagcgtttagatggacgtaacctgaccgatgagtggacagca
aaatacaccaactcagcttatgtcgaagacagagatagctttttagccattaatcctgca
accacagatcatgcccttggcttgttcaactcatcccatatggagtatgactacgaccgc
acaattcaaggtgtgacgggggagccttcactggcagagatgacagctaagagcatcgat
attttgaagaaaaatgataagggttttgtgctgattgtcgaagcgggtcgtatcgaccat
gctcaccatgcagggaacgcagcaagagccctctatgacaccatagccctctctgaagct
gtccgtgtcgccatggagaaaacctcgacgaaagacacactgcttatggtcacagccgat
cacagtcatgtgtttaccattgccggttacccaacgcgaggcaacccaatacttggccta
gtgaagggcaatgactcttctggcctgccaggcccaactaatgcaaccgacaacaatgga
ctgccatacaccactgtgggttacaccaatggacgcggctatgccaacctaagcacaggc
ggtgatgagcgttatggctacccggtagaaactggacgggtcgatcttaactatatcgat
actcaaagtgcaggctttcaccaagaagcacttgttccgctatcgagtgaaacccatgca
ggtgaagatgttggtatatttgcaagtggtccaggctctcatctcattgaaggcactgtt
gagcaaaaccatatcttccatgtcattaatcatgctgccaacttagttgtcaaagctgaa
gctgctcagtaa

DBGET integrated database retrieval system