KEGG   Shewanella woodyi ATCC 51908: Swoo_1391Help
Entry
Swoo_1391         CDS       T00676                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:swd00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:swd00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:swd00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:swd00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:swd00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1747018..1747980)
Genome map
AA seq 320 aa AA seqDB search
MRNHKMVNKKINIALIGSGNIGTDLMIKALRSSTLNPVWMVGIDENSDGLKRAKALGLKT
THLGIDELLTHIEADNIQIAFDATSAYVHEENNRKLQSKGVKVIDLTPAAIGPYCIPPVN
LESLLSQTENQTQINDGSISGNLNMVTCGGQATIPIIAAISRVQSVDYGEIVATIASKSA
GPGTRKNIDEFTRTTADAIEQIGGARQGKAIIVMNPAEPPLMMRDTVHCLTQDEPDVEAI
TASVLSMIEQVQEYVPGYRLKNGPVFDGNRVSVFLEVAGLGDYLPEYAGNLDIMTSAALC
TGEMLARNLRSNMSVKDSHH
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcataaaatggtgaataaaaaaatcaatatcgccctgattggctcaggcaat
atcggcacagatctgatgataaaagcccttagaagcagtacgctaaatccagtctggatg
gtgggaatagatgaaaactctgacggtcttaaacgcgctaaggcgctcgggctaaaaacc
acccacttaggtatagatgagctactaactcatattgaagcagataatattcagatagcc
tttgatgccacctcagcttatgtccatgaagagaataaccgcaaactgcaaagtaaggga
gtgaaggttatcgatctcacccctgccgctattggtccctactgtattccgccagttaat
ctcgagagcttactttcacaaaccgagaaccaaactcaaataaacgatggttcaatatcg
ggtaacttaaatatggtgacctgtggtggtcaggcgaccattcccattatcgctgccata
agtcgcgttcaaagcgtcgactacggtgaaatagtcgccaccatagcttcaaaatcagca
ggcccgggtacacgcaaaaatattgatgagtttacccgaacaactgctgatgccatcgag
cagataggcggggctcgccaaggtaaagccattatcgtcatgaaccccgctgaaccacca
cttatgatgcgcgacaccgttcactgcttgactcaggatgaacctgacgttgaagcgatc
actgcatcagtgctctctatgattgaacaggttcaagagtatgttcctggttatcgactg
aaaaatggtcctgtatttgatggtaaccgggtatcggtatttcttgaggtcgcaggcctt
ggggactatttacctgaatacgcgggtaatctggatattatgacctcagcagccctctgc
acaggtgagatgttagcccgtaacttacgctcaaacatgagcgtcaaagatagccaccac
taa

DBGET integrated database retrieval system