KEGG   Shewanella woodyi: Swoo_1528Help
Entry
Swoo_1528         CDS       T00676                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
swd  Shewanella woodyi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swoo_1528
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swoo_1528
   00630 Glyoxylate and dicarboxylate metabolism
    Swoo_1528
Enzymes [BR:swd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Swoo_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1904877..1906283
Genome map
AA seq 468 aa AA seqDB search
MAQEVIHNAQQGAMDVAQLGLDANCDVAAHLQAGYISAPVETNKTQERLKVNGEVVDGQD
KVLNEGALSLLSSLCRQFAAEVSELLENRKSQQAKYDAGGTLDFLPQTKAVREGNWQVRG
IPADLINRRVEIAGSVDPLMLINGLNSNANVFVADLEESPASSWNELIEKQVNLRGAVRG
EIEFTSPETGKYYLLNDAPAVLFCRVRGLHMVEHHLEFDEAAIPAALFDFALYFYNNYRQ
LLAKGSGPYFYLPKMESHLEAKWWAKVFAFVEERFCLQPGTIKCTCLIETLPAVFEMDEI
LFELRSNIVALNCGRWDSDFSYINTGRNHSDELSTDKQMFTVGESFLSVYSRLLVKTCHK
RGALAIGGVATYFQAKTNEISAERLEKIRIDKELEARNGHDGTCVEHLELVDAVTEIFNQ
YIGAEQANQLHITRDVDGPISARELLQGVGITTNVRLDIRADSESNAA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagaagtgatacataatgcacagcagggagctatggacgtggctcagcttgga
ctcgatgcaaattgtgatgtcgcagctcatctacaagcaggttatatcagtgctccagtt
gaaaccaataagacgcaggagaggcttaaggttaatggtgaagttgttgatggtcaggat
aaggtgttaaacgagggggcactgagcctgctctctagtttgtgtcgtcagtttgctgct
gaagtttctgagttattagagaatagaaaaagccaacaagccaagtatgatgcaggcggc
actctggattttttacctcaaactaaagccgttagagaggggaattggcaagttagaggg
atccctgcagacctcattaatagaagagtggagattgccggttctgttgatccattgatg
ctcattaatggattaaactcgaatgcaaacgtgtttgtggctgatttagaggagtcacct
gcatcgagctggaatgagttgattgagaagcaagttaacttacgaggtgctgtgcgtggg
gagattgagttcacctcaccagagactggtaaatattatctgttaaatgatgctcctgcc
gtgctgttctgccgagttcgtggcctacatatggttgaacatcatcttgagtttgatgaa
gccgctattccagctgctttattcgattttgctctctacttttataataactatcgacag
ttattagctaagggcagtggtccctatttttatttgcctaaaatggaaagccatctagaa
gcaaaatggtgggctaaggtttttgcttttgttgaggagcgtttctgcttacagcctggc
accatcaaatgcacttgtttgattgaaactttgccagctgtttttgagatggatgagatc
ttatttgagctgagatccaatatcgtggcgcttaattgtggacgctgggattcagacttt
agttacattaatactggccgaaaccatagtgatgagttatcgactgataaacagatgttt
accgtgggagagtcgtttttaagtgtctactctcgtctgttagtcaagacgtgtcataag
cgtggtgcattagcgattgggggagtggcaacctattttcaggctaaaacgaatgaaatc
agtgcagaacgactcgaaaaaattcgtatcgataaagagctagaagctagaaatgggcat
gatggaacttgcgttgaacatctagagttagtggacgctgtcacggagatatttaatcaa
tatattggagcagaacaggccaaccaacttcatattactcgtgatgttgatggtcctatt
agtgcaagagagctgctacaaggcgttggaattacaactaacgttaggctggatatcaga
gctgatagcgagtcaaatgccgcctaa

DBGET integrated database retrieval system