KEGG   Shewanella woodyi: Swoo_1714Help
Entry
Swoo_1714         CDS       T00676                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
swd  Shewanella woodyi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Swoo_1714
   00052 Galactose metabolism
    Swoo_1714
   00500 Starch and sucrose metabolism
    Swoo_1714
   00520 Amino sugar and nucleotide sugar metabolism
    Swoo_1714
Enzymes [BR:swd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Swoo_1714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2130133..2131050)
Genome map
AA seq 305 aa AA seqDB search
MKQHKICKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNEAINAGINEIVLVTH
ASKNPIENHFDTSFELEAQLERRVKRQLLSEIQSICPRGVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVLVDEASCDLRNDNLAEMVKLYDQTETGQIMVEGVPIDQVDQYGI
ADVKGHDLQPGESVPLAQLVEKPNINVAPSNLAVVGRYILPADIWPLLAKTPAGAGDEIQ
LTDAIAMLMEKQTVNAYYMKGKSHDCGNKQGYMQASVEHALRHKEIGHDFKQYLKQLVNE
FDEEK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacataaaatttgcaaagctgttattcctgtcgcgggacttggaacaaggatg
cttccggcaacgaaagcgatacctaaagagatgttacccgtcgttgataaaccgcttatt
caatatgttgtcaatgaagcaattaacgctgggatcaatgaaatcgtacttgttacccat
gccagtaaaaatcccatcgaaaaccattttgataccagttttgaacttgaagcccaactc
gaaagacgagtaaaacgtcaactgttatccgagatccaatctatctgccctaggggtgtc
accgtcattagtgtgcgtcaatcacaagccaaagggttaggccatgccattttatgtgca
aagtctgtggttggtgatgcgccttttgccgttcttcttcccgatgtcctagtggatgaa
gccagctgcgatctgcgtaacgacaatcttgcagagatggttaagctctatgatcaaact
gaaactggccagataatggttgagggagtaccaatagatcaggttgatcaatacggcata
gccgatgttaaagggcatgacctgcaaccgggtgaatctgtccccctagctcaattagtt
gagaagcccaatattaatgtcgccccttccaatctagcagtcgtcggccgttatatttta
cctgcagatatttggccactgcttgcaaaaactccagcaggagccggtgatgagatacag
ttaaccgatgcgattgccatgctaatggaaaaacaaacagttaacgcctactacatgaag
ggcaagagccatgactgtggtaataaacaaggttatatgcaagccagtgtagaacatgca
cttcgccacaaagagatcggtcatgatttcaagcaatatcttaagcagttagtcaacgaa
ttcgacgaggaaaagtaa

DBGET integrated database retrieval system