KEGG   Shewanella woodyi ATCC 51908: Swoo_1807Help
Entry
Swoo_1807         CDS       T00676                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:swd00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:swd00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2235310..2236323
Genome map
AA seq 337 aa AA seqDB search
MSYLMLDLLSTQASAEELTQLKHPMVGGVILFSRNYTDRPQLVSLVESLRVVRPDLLIAV
DHEGGRVQRFRDGFTHIPAMGDILPFAGGDMILAKKWAVELGFLMAVELLACDIDLSFAP
VLDLNRVSEVIGKRAFSSEPNEVIELAGSFIEGMHQAGMASVGKHFPGHGSVVADSHIAQ
PYDERSKEEILELDMQPFKSLIAKDQLHGVMPAHVIYSKVDPNPAGFSSFWLQDILREQL
SFRGVIFSDDLGMKGAGVVGGYKARAQAALDAGCNMILICNDAKGATEVLEELVWPTSQP
EYPAQLLKPDSKIVAQALQNDERWQQAKLLASRFSTD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgagttacttaatgcttgatctgctttctacccaagcttctgcagaggagcttactcag
ctgaaacaccctatggttggaggggtgatcttattcagtagaaattatactgatcgtccg
caacttgtctcattagtagagtcgctccgtgttgttaggccagatcttcttattgcagtc
gatcatgaggggggaagagtacagcgctttagggatggttttacccatataccggctatg
ggagacattcttccatttgctggcggcgatatgatacttgctaaaaaatgggctgtagag
ttaggttttcttatggctgtggagcttttggcttgtgatattgatttgagcttcgcacct
gtgcttgatcttaatcgtgtcagtgaggtgataggtaagcgtgcatttagctctgaaccc
aatgaagtcattgagcttgctggaagctttatagaggggatgcatcaagctggtatggca
tctgttggtaaacactttccaggacatggcagtgtggttgctgattctcatattgctcag
ccttatgatgagcgtagtaaagaggagatccttgagctagatatgcaaccttttaaatcg
ctgatagccaaagatcagctccacggtgtgatgcccgcacatgtgatctattcaaaggtt
gatccaaatcctgctggtttttcatcattttggctgcaagatatattacgtgaacagtta
agttttcggggagtgatattctctgatgatctagggatgaagggggcgggagttgtgggc
gggtataaagccagagctcaagccgcattagatgcaggttgtaatatgattttgatatgc
aatgatgccaagggagctacagaggtacttgaagagttagtttggccgaccagtcagcct
gaatatccagctcagttattgaagcctgatagtaaaatcgttgcacaagctcttcaaaac
gatgaaaggtggcagcaagccaaactccttgcatcaagattttcaacagattaa

DBGET integrated database retrieval system