KEGG   Shewanella woodyi: Swoo_1838Help
Entry
Swoo_1838         CDS       T00676                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
swd  Shewanella woodyi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swoo_1838
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Swoo_1838
  Amino acid metabolism
   00310 Lysine degradation
    Swoo_1838
Enzymes [BR:swd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Swoo_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2273960..2275150
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVQPGEQVTRDQNLVDIETDKVVLEVVAPEDGSIAEFL
ANEGDTVLGEAVIAKFTAGAVAGQEVTKAEAEATTPEAADDTNDALSPSVRRLLGEHGLE
ASQVKGTGAGGRITKEDVEAFVKSKSAAPAPTASAQVDVAPLAERSEKRVPMSRLRKTIA
NRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQEVFEKRHGIRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMSLADIERNVRELAIKGRDG
KLTVDDMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIIDGRESVGYLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgtactaccagaatctgttgctgatgcaactattgct
acttggcatgttcagcctggtgaacaagtaacacgtgatcaaaaccttgttgatattgaa
actgacaaggttgtacttgaagtggttgcccctgaagatggatcgattgctgaatttcta
gcaaacgaaggcgacactgttcttggtgaagctgtcatcgctaagttcactgctggcgct
gttgctggtcaagaagtgacgaaagcggaagctgaggccaccacacctgaagctgctgat
gacaccaatgatgctctaagcccatctgttcgccgtttactgggtgaacatggtcttgaa
gcaagtcaagttaaaggcactggtgctggcggtcgaattacaaaagaagatgttgaagcg
tttgtgaagagcaagtcagcagctcctgcaccgacggctagtgcacaggtagatgttgca
ccattagctgagcgtagcgagaagcgtgtacctatgtcacgtcttcgtaagacaattgca
aaccgtctacttgaagctaaaaactctacagctatgttgacgacatttaatgaagttaac
atgaagccaatcatggatatccgtaagcagtatcaagaggtttttgagaagcgtcatggg
atccgtttaggttttatgtctttctacattaaagcggtaacggaagcgttgaagcgtttc
cctgaagtgaacgcttctatagatggtgatgatattgtttatcacaactactttgatatc
agcattgcggtgtcaacgccacgtggtcttgtgacacctgttcttcgtgatacagacacc
atgagccttgcagatatcgagcgtaatgttcgtgaacttgcaattaaaggtcgtgacggt
aagttgactgttgatgatatgactggcggtaacttcactgtgactaatggcggtgtattt
ggttcactcatgtccaccccaattcttaatctgccacaaagtgcaatccttggtatgcat
gccatcaaggatcgcccaatggcagtgaatgggcaggttgaaatcctacctatgatgtac
ctagcattatcttacgatcaccgtattatcgatggtcgtgagtcagttggttacttggtt
gccattaaggacttcctcgaagacccaactcgtctgctgcttgatctataa

DBGET integrated database retrieval system