KEGG   Shewanella woodyi: Swoo_1915Help
Entry
Swoo_1915         CDS       T00676                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
swd  Shewanella woodyi
Pathway
swd00010  Glycolysis / Gluconeogenesis
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swoo_1915
Enzymes [BR:swd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Swoo_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACA86199
UniProt: B1KPP6
Position
complement(2360750..2361598)
Genome map
AA seq 282 aa AA seqDB search
MGSVTTKKHANGLEYVDVDTPACKARIFLQGAQIDFFQPTGKAPLLWVSSADDYQAGSGI
RGGIPVCWPWFGMNDNSDWPQHGFARTRLWALESVQMKDSGVELRFTLKISEEDKLYWPH
DTRVEMLFILNGTLTVSLKNTNLSGYPISFTQALHTYFPIGDISQLKAKGFEGSQYIEFG
EGPFKQQGDEVSFDKETDRVYTKLSDLQELVTPEGVIEVNRENSRSAVLWNPWIEKSQRL
SRFNSDDYLSMVCLEAANVLDDAVTLAPDESHTLTTKIRWKS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagtgacaactaaaaagcacgccaacggattagagtacgtcgatgttgatact
ccggcatgtaaagccagaattttcttacaaggggcgcaaattgactttttccagccaacg
ggaaaagcgcccttactttgggtctcatctgcagatgattatcaagcaggtagcgggatc
agaggcggaatacctgtctgctggccctggtttggcatgaacgataactctgactggcca
caacatggctttgcccgtacccgattatgggcactagagtctgtacagatgaaagattct
ggcgtcgagcttaggtttacgctgaaaattagtgaggaagataagctttattggccccac
gatactcgagtcgaaatgctatttatcttaaatggcaccttaacggtatcccttaaaaat
acaaacttgtctggttaccccattagttttacgcaggcactgcatacctacttccctatt
ggggatatctctcaactcaaggccaaagggtttgaaggttctcaatacattgaatttgga
gaaggcccgttcaagcaacaaggtgatgaggtctccttcgacaaagagacagatcgcgtc
tataccaagctaagtgatctgcaggagctagtgacacctgagggtgtgatagaggttaat
cgtgaaaatagtcgttcagctgtactctggaacccttggatagaaaaatctcaacgcctt
tctcgattcaatagcgacgactacctctctatggtctgcttagaagcagctaacgtacta
gatgatgcagtaactttagcccctgatgaatcacacaccttaaccactaagatccgttgg
aagagttaa

DBGET integrated database retrieval system