KEGG   Shewanella woodyi: Swoo_2012Help
Entry
Swoo_2012         CDS       T00676                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
swd  Shewanella woodyi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Swoo_2012
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swoo_2012
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swoo_2012
Enzymes [BR:swd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Swoo_2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2471726..2473048
Genome map
AA seq 440 aa AA seqDB search
MDQLKDKLRSNNVNKLDYQLSLEDMPTQWFNFFPHLPKPLPPVRDNGKRSTLEISQLIRP
KILLEQNAPKENWIDIPEEVINKLIMCGRPTPLRRALSLEKHLKTPARIYFKREDTMATG
SFKLSTAVAQAYYAKQEGREILISETGAGQWGMSVALVSQMFGLDARIFMARCSLEQKPY
RQHYMKMLGCEVYPSPSTKTECGKELLLQTPGHPGSIGSAISEAIENALDTPGSAYLSGS
NVNHVHLHQTLLGLEVKQQLSMAGESNVDHLVACVSGGSNLCGFMMPFLPEKNSGAKIDM
LGVESTASPRLTQGTYEYCRSDVAGYTPEVLSHSMGESYIPAPVHVGGLRNHNSSPLVSL
LCREGILRAEALDEFNAFKAGQIMLKTEGILVAPESSHAVAAAIDLAEKARIENKESVIV
FLASGNGFLDLQGYNDVLNN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggatcaattgaaggataagctcaggtcaaataatgtgaataaattagattaccaactc
tctttagaagatatgcccactcagtggtttaatttcttcccccacctacctaaaccatta
cctccagtaagggacaatgggaagcgttcaactctggagattagccagttaattcgccct
aaaatattacttgagcaaaacgcgccaaaagagaattggatagatattcccgaagaggtg
ataaataagttgatcatgtgtggtcgaccgacaccattgcgcagagcattgagtctagag
aaacaccttaagacgcctgcaagaatctactttaagcgggaagacaccatggcgacaggg
agttttaaactctccactgcagttgcacaagcatactatgcgaaacaagaaggtagagag
attcttatatcggaaaccggtgcaggacaatgggggatgagtgttgctttggtgagtcag
atgtttggccttgatgctcgaatatttatggctaggtgttcattagagcaaaaaccgtat
cggcaacattatatgaaaatgcttggatgtgaagtatatccttcaccgtcaactaaaaca
gagtgtggtaaagaacttctactccaaactccaggtcaccctggaagtattggtagcgcg
attagtgaggctattgagaatgctttagacacgccgggatctgcttatttatctggaagc
aatgtaaatcatgtgcacttacatcaaaccttgcttggtttagaggttaagcagcagcta
tcgatggctggtgaatctaatgtggatcatcttgtagcttgtgtcagtggcgggagtaat
ttatgcggctttatgatgccatttctgcctgagaagaacagtggagccaaaattgatatg
ttgggtgtggagtcaactgcctccccacgattaacccaaggaacctatgagtactgtcgc
tctgatgttgctggttatacgccagaagtgctgagtcactccatgggagagagttacata
cctgctccagttcatgtgggcggtttacgaaatcacaatagctcccccttagtcagtcta
ctctgtcgagaaggtattcttcgcgcggaggcattagatgaatttaatgcctttaaagcg
ggccaaataatgctgaaaacagagggaatattagtcgcgcctgagtcttcccatgcggtt
gctgctgccatcgatcttgcggaaaaagcacgcatagaaaacaaagaatctgtgattgtg
tttttagctagcggtaatggttttttggatctgcaaggttacaacgatgtattaaataat
tga

DBGET integrated database retrieval system