KEGG   Shewanella woodyi ATCC 51908: Swoo_2126Help
Entry
Swoo_2126         CDS       T00676                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
swd  Shewanella woodyi ATCC 51908
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2602385..2603410)
Genome map
AA seq 341 aa AA seqDB search
MSKELMQVAALNLKKAVPLMLKHQIPTTPTNYALWYAYVGEQQPQLNEQLDTIINEHSTC
PPSNSTLLYREFVADPVELDVIDMRQNLEAMATELSQSLKDTNTDATHFQKRIDSNFDKL
NRIEEEGVSLEKVLGVVRNLVKESDEIRSSTEYFTGHLKRAQQEIDALKAQLKKSEKDVL
FDALTGVLNRRAFDSDLKGSLSQSPDGLCLILIDIDHFKAFNDNYGHQLGDQVLKAVAKR
LGESCREGTKLYRYGGEEFAVITANSQLRKARHLAEAMRRALEKVSLKDRRKDAMINNIT
ASFGVAQWDPSLSATQLIEQSDKLLYEAKRLGRNRVMPIAS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagaacttatgcaagtcgctgcactcaatttaaaaaaagcggtccctttgatg
ctcaaacatcaaattcccacaacaccgactaactatgcgctctggtacgcctatgtaggt
gaacagcaacctcagcttaatgaacaactcgatacgattattaatgagcacagcacctgc
cctccctcaaactcaacactgctctatcgtgaatttgttgccgatccggttgaactagat
gtcattgatatgagacaaaaccttgaagcgatggccaccgagctttctcagtctctaaaa
gataccaacacagacgccacacacttccaaaaacggattgacagtaactttgataaactc
aaccgcattgaggaggagggagtcagtcttgagaaagtattgggtgtggtgcgaaaccta
gtgaaggaatccgatgaaatacgttcgagcactgagtactttactggtcatcttaaacgg
gcccaacaagagattgatgcattaaaggcgcaattaaagaaatcagaaaaagatgtccta
ttcgatgctttaactggcgtgttgaaccgaagagcttttgattcagatctaaagggttcc
ctaagccaatcgccagatggactctgtttgattcttatcgatatcgaccatttcaaagca
ttcaacgacaactatggccaccagttaggggatcaagtactaaaagccgttgctaaacgt
ctgggggaatcttgtagagagggaaccaagctgtaccgctacggaggagaagagtttgcc
gttatcacagccaatagccagttaagaaaagccaggcacttggcagaagcgatgcgcaga
gcccttgagaaggtctcactaaaagacagacgaaaagatgccatgatcaacaatatcacg
gcctcttttggtgttgcacaatgggatccttcgctctctgccacccagctaatagagcaa
tcggataaactactctacgaagctaagcggttgggcagaaaccgagtaatgcctattgcc
agctaa

DBGET integrated database retrieval system