KEGG   Shewanella woodyi: Swoo_2236Help
Entry
Swoo_2236         CDS       T00676                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
swd  Shewanella woodyi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swoo_2236
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swoo_2236
   00630 Glyoxylate and dicarboxylate metabolism
    Swoo_2236
Enzymes [BR:swd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Swoo_2236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2743601..2745778
Genome map
AA seq 725 aa AA seqDB search
MTSRVQVGSLQVAQVLFDLVNDKILPGTEITAERFWSQLEAIVSDLTPKNRALLQKRDEL
QAKIDEWHLNQHSNQQQFDLNSYKEFLTEIGYLVKVGPDFSIETENVDTEIAEQAGPQLV
VPVKNARFALNAANARWGSLYDALYGTDAISEEGGAELGSSYNPVRGDKVIAFAKQHLDQ
LAPLSIGSHSEARHYQVAGGKLLVTLLDGCDTGLQEPEKFVGFQGDKICPSAVLLKNNGL
HVEIQIDKDHRIGKQDSANVKDLLVEAAVTTIMDCEDSVAAVDAEDKCEVYENWLGLMQG
NLNAELNKGGKTITRELSQDRDYQAPLGGKLTLPGRSLLFVRNVGHLMTNNAILDKDGKE
IPEGILDGMVTVLAAIHDLQGHNNGRSNSRVGSVNIVKPKMHGPEEVAFTCELFTRIEDA
LKLSRDTIKLGIMDEERRTTVNLKECIRVAKDRVVFINTGFLDRTGDEIHTSMLAGPFVP
KSMMKQQAWINAYEDWNVDIGLACGLPGRAQIGKGMWAMPDEMAKMLEQKIGHPNAGANT
AWVPSPNGASLHSIHYHRVNVLERQKELAQRERASLDDILTIPLLENPASLTHEEVEKEL
DNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQYITNWLEHKICTKEQV
LASLKRMAVVVDGQNSADNEYQAMAPQFDGIAFKAACDLIFEGKEQPSGYTEPLLHAYRI
EAKAS
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgagtgcaggttggcagtttacaggtggcacaagtgctatttgatctggtc
aatgacaagatccttccaggaacggagatcaccgcggagcgcttttggagtcagttagaa
gcgatagtgagtgatcttacgcctaaaaatagagcgctacttcaaaagcgtgatgagcta
caagctaagatagatgagtggcatctaaatcaacactcaaaccagcagcagttcgatctt
aatagctataaagagtttttaactgaaataggttatctagtgaaagttggtccagacttt
tcaatagagacagagaatgttgatactgaaatagcagaacaagctggtcctcagttagtt
gtgcctgttaaaaatgccagatttgcccttaatgcagctaatgcacgttggggaagtttg
tatgatgcactttatggcactgatgctatcagtgaagagggcggggctgagctaggttca
agttataaccctgttcgtggtgataaagttattgcatttgcaaagcaacatttagatcaa
ttagcgccactttccataggtagccatagtgaagcccgtcattatcaagtggctgggggg
aagttacttgtgactttactcgatggctgcgatactggcctgcaggagcctgagaagttc
gtcggtttccaaggtgacaagatctgcccatcggctgttctgctgaaaaataatggtctg
catgtggagatccagatagataaagatcatcgtattggtaaacaggactctgccaatgtt
aaagacctgctggtggaagcggctgtaaccaccattatggattgtgaagactctgtcgct
gcggtcgatgctgaagataagtgtgaagtgtatgaaaactggctcggcctaatgcaaggt
aacctcaatgctgagctaaacaaaggcggtaaaacgattacccgtgagctgagtcaagac
agagattaccaagcacctttagggggcaagttgaccctgcccggacgtagcttactgttt
gttcgtaatgtgggtcacctgatgacaaacaacgcgatactagacaaagatggcaaagag
atcccagaggggattttagatggcatggtaacagtgcttgccgccatacatgatcttcaa
ggtcataataatggtcgttcaaatagccgtgtaggctctgtcaatattgtgaaacctaag
atgcacgggcctgaagaggtcgcatttacttgtgagctgtttacccgtattgaggatgcc
cttaagttgtctcgagataccattaagcttgggatcatggatgaggagcgtcgtactacc
gtgaaccttaaagagtgtatccgagttgccaaagatcgtgtggtatttatcaacacaggt
tttctcgatagaactggcgatgagatccacacctcgatgctggcagggccatttgtgcct
aaatctatgatgaagcagcaagcttggatcaatgcttatgaagattggaatgtcgatatt
ggcttagcatgtggcttgcctggacgtgctcagataggcaaaggtatgtgggccatgcca
gatgagatggccaaaatgcttgagcagaagattgggcaccctaacgccggcgctaacact
gcttgggttccatcgccaaatggcgcaagtttgcactcaattcattaccatagagtcaat
gtgcttgagcgacaaaaagagctagctcaaagagagcgggcaagtttggatgatatatta
acgatccccttacttgaaaatccagcttcgctcacccatgaggaggttgagaaagagcta
gataacaatgctcaaggtattttaggttatgtggtgcgctggatagatcaaggtgtgggc
tgctctaaagtgccagatattaataatgttggattgatggaggatagggcgacactgcgg
atctcctcccaatatattactaactggcttgagcataagatctgtacaaaggagcaagtg
cttgcctcacttaagcgaatggctgttgtggttgatggtcaaaatagtgctgataatgaa
tatcaagctatggcaccacaattcgatggcatcgcctttaaagcggcttgtgatctgatt
tttgaaggtaaggagcagccatctggctatacagagcctttgctacacgcataccgaatc
gaggctaaagcgagctaa

DBGET integrated database retrieval system