KEGG   Shewanella woodyi: Swoo_2236Help
Entry
Swoo_2236         CDS       T00676                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
swd  Shewanella woodyi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swoo_2236
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swoo_2236
   00630 Glyoxylate and dicarboxylate metabolism
    Swoo_2236
Enzymes [BR:swd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Swoo_2236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2743601..2745778
Genome map
AA seq 725 aa AA seqDB search
MTSRVQVGSLQVAQVLFDLVNDKILPGTEITAERFWSQLEAIVSDLTPKNRALLQKRDEL
QAKIDEWHLNQHSNQQQFDLNSYKEFLTEIGYLVKVGPDFSIETENVDTEIAEQAGPQLV
VPVKNARFALNAANARWGSLYDALYGTDAISEEGGAELGSSYNPVRGDKVIAFAKQHLDQ
LAPLSIGSHSEARHYQVAGGKLLVTLLDGCDTGLQEPEKFVGFQGDKICPSAVLLKNNGL
HVEIQIDKDHRIGKQDSANVKDLLVEAAVTTIMDCEDSVAAVDAEDKCEVYENWLGLMQG
NLNAELNKGGKTITRELSQDRDYQAPLGGKLTLPGRSLLFVRNVGHLMTNNAILDKDGKE
IPEGILDGMVTVLAAIHDLQGHNNGRSNSRVGSVNIVKPKMHGPEEVAFTCELFTRIEDA
LKLSRDTIKLGIMDEERRTTVNLKECIRVAKDRVVFINTGFLDRTGDEIHTSMLAGPFVP
KSMMKQQAWINAYEDWNVDIGLACGLPGRAQIGKGMWAMPDEMAKMLEQKIGHPNAGANT
AWVPSPNGASLHSIHYHRVNVLERQKELAQRERASLDDILTIPLLENPASLTHEEVEKEL
DNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQYITNWLEHKICTKEQV
LASLKRMAVVVDGQNSADNEYQAMAPQFDGIAFKAACDLIFEGKEQPSGYTEPLLHAYRI
EAKAS
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacgagtgcaggttggcagtttacaggtggcacaagtgctatttgatctggtc
aatgacaagatccttccaggaacggagatcaccgcggagcgcttttggagtcagttagaa
gcgatagtgagtgatcttacgcctaaaaatagagcgctacttcaaaagcgtgatgagcta
caagctaagatagatgagtggcatctaaatcaacactcaaaccagcagcagttcgatctt
aatagctataaagagtttttaactgaaataggttatctagtgaaagttggtccagacttt
tcaatagagacagagaatgttgatactgaaatagcagaacaagctggtcctcagttagtt
gtgcctgttaaaaatgccagatttgcccttaatgcagctaatgcacgttggggaagtttg
tatgatgcactttatggcactgatgctatcagtgaagagggcggggctgagctaggttca
agttataaccctgttcgtggtgataaagttattgcatttgcaaagcaacatttagatcaa
ttagcgccactttccataggtagccatagtgaagcccgtcattatcaagtggctgggggg
aagttacttgtgactttactcgatggctgcgatactggcctgcaggagcctgagaagttc
gtcggtttccaaggtgacaagatctgcccatcggctgttctgctgaaaaataatggtctg
catgtggagatccagatagataaagatcatcgtattggtaaacaggactctgccaatgtt
aaagacctgctggtggaagcggctgtaaccaccattatggattgtgaagactctgtcgct
gcggtcgatgctgaagataagtgtgaagtgtatgaaaactggctcggcctaatgcaaggt
aacctcaatgctgagctaaacaaaggcggtaaaacgattacccgtgagctgagtcaagac
agagattaccaagcacctttagggggcaagttgaccctgcccggacgtagcttactgttt
gttcgtaatgtgggtcacctgatgacaaacaacgcgatactagacaaagatggcaaagag
atcccagaggggattttagatggcatggtaacagtgcttgccgccatacatgatcttcaa
ggtcataataatggtcgttcaaatagccgtgtaggctctgtcaatattgtgaaacctaag
atgcacgggcctgaagaggtcgcatttacttgtgagctgtttacccgtattgaggatgcc
cttaagttgtctcgagataccattaagcttgggatcatggatgaggagcgtcgtactacc
gtgaaccttaaagagtgtatccgagttgccaaagatcgtgtggtatttatcaacacaggt
tttctcgatagaactggcgatgagatccacacctcgatgctggcagggccatttgtgcct
aaatctatgatgaagcagcaagcttggatcaatgcttatgaagattggaatgtcgatatt
ggcttagcatgtggcttgcctggacgtgctcagataggcaaaggtatgtgggccatgcca
gatgagatggccaaaatgcttgagcagaagattgggcaccctaacgccggcgctaacact
gcttgggttccatcgccaaatggcgcaagtttgcactcaattcattaccatagagtcaat
gtgcttgagcgacaaaaagagctagctcaaagagagcgggcaagtttggatgatatatta
acgatccccttacttgaaaatccagcttcgctcacccatgaggaggttgagaaagagcta
gataacaatgctcaaggtattttaggttatgtggtgcgctggatagatcaaggtgtgggc
tgctctaaagtgccagatattaataatgttggattgatggaggatagggcgacactgcgg
atctcctcccaatatattactaactggcttgagcataagatctgtacaaaggagcaagtg
cttgcctcacttaagcgaatggctgttgtggttgatggtcaaaatagtgctgataatgaa
tatcaagctatggcaccacaattcgatggcatcgcctttaaagcggcttgtgatctgatt
tttgaaggtaaggagcagccatctggctatacagagcctttgctacacgcataccgaatc
gaggctaaagcgagctaa

DBGET integrated database retrieval system