KEGG   Shewanella woodyi: Swoo_2241Help
Entry
Swoo_2241         CDS       T00676                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
swd  Shewanella woodyi
Pathway
swd00010  Glycolysis / Gluconeogenesis
swd00071  Fatty acid degradation
swd00350  Tyrosine metabolism
swd00620  Pyruvate metabolism
swd00625  Chloroalkane and chloroalkene degradation
swd00626  Naphthalene degradation
swd00650  Butanoate metabolism
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
swd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swoo_2241
   00620 Pyruvate metabolism
    Swoo_2241
   00650 Butanoate metabolism
    Swoo_2241
  Lipid metabolism
   00071 Fatty acid degradation
    Swoo_2241
  Amino acid metabolism
   00350 Tyrosine metabolism
    Swoo_2241
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Swoo_2241
   00626 Naphthalene degradation
    Swoo_2241
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Swoo_2241
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Swoo_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACA86522
UniProt: B1KEE4
Position
complement(2747969..2750569)
Genome map
AA seq 866 aa AA seqDB search
MTVSNEQELDLLVQRVADAQAEFASFSQEQVDKIFRAAALAAADARISLAKMAANETGMG
VIEDKVIKNHFASEYIYNKYKDEKTCGILSEDHTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKESTTTAARIVLNAAIEAGAPKDIIGWIDQPSVALSNQ
LMTHEKINLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVVVVDEIYESVKERFATHGGYILSTDEAAAMQNVILKNGGLNADIVGQS
AVTIAAMADITVPKWTKVLIGEAEDISDAEAFAHEKLSPLLAMYRASDFEDALDKAEALV
TLGGIGHTSGLYTDQDTQTERVMAFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKMVAKRAENMLWHKLPSSIYFRRGSLPIALEELSDKKRA
LIVTDKYLFNNGYCDETLKILKAQGLETEVFYEVEADPTLAIVQQGAKVAQSFQPDVIIA
LGGGSPMDAAKIIWVLYEHPAVDFADLALRFMDIRKRIYKFPKLGVKAQMVAIPTTSGTG
SEVTPFAVVTDEKTGMKYPIADYQLTPNIAIVDPNLVMDMPKSLTAFGGIDAVTHALEAY
VSVMANEFSDGQALQALDLLFKYLPDSYTLGAAAPVAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLISNVIRFNATDMPTKQAAFSQYDRPKALCRYAKIAEHL
NLAGNTDEEKVEALLEAIDQLKATIGIPASIQEAGVNEADFLAKLDELAEDAFDDQCTGA
NPRYPLIAELKQVLLDSFYGNKYSDK
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgtcaaacgaacaagagttagaccttcttgtccagagagttgctgatgcccag
gctgagtttgccagcttcagtcaagaacaggttgataagatattcagagccgccgcactg
gccgctgctgatgcgcggatctcgctcgctaagatggctgctaatgaaacaggcatgggt
gtgatagaagataaagtgatcaaaaaccactttgcttccgagtatatctacaacaagtat
aaagatgagaaaacctgtgggatcttaagtgaagatcacaccttcgggacaatcaccatc
gccgagcctgtcggcattatctgcggtatcgttccaaccaccaacccgacctctaccgct
atctttaaagcattaatcagtctcaagactcgaaacggtatcatattctctccacatcca
cgtgccaaagaatcaaccactaccgctgcgcgaatagtactcaatgcagcgattgaggcg
ggtgctccaaaagatattatcggttggattgaccaaccaagtgtagccctatcaaaccag
ttaatgacccacgagaagataaaccttatcttagcaaccggtgggcctggtatggttaaa
gccgcctactcctcaggtaagccagccattggtgttggcgcgggcaatacacccatagtt
atcgatgaaaccgccgatattaaacgcgccgtcagttcaatcttgatgtcaaaaaccttc
gataacggtgttgtttgtgcgtctgaacaagcagtcgttgttgttgatgagatctatgaa
tcagtcaaggagcgttttgcaacccacggcggctatatattaagcacagatgaagccgca
gcaatgcagaatgtcatcttaaaaaatggtggtctaaacgccgatatcgtaggacaaagc
gcggtaaccatcgcagccatggccgatattacagtgccaaaatggactaaagtgcttatt
ggtgaggctgaagatatctctgatgccgaagcctttgcccatgaaaagctctctccactg
cttgctatgtaccgcgccagtgattttgaagacgccctagacaaggcagaagctttagtt
acccttggtggtatcggtcacacatctggattatatacagatcaagacacccagactgaa
cgtgtgatggcgtttggttttagaatgaaaacagcccgtattctgatcaatacgcctgct
tcacagggcggaattggtgacctgtataacttcaaactggcaccatccctaaccttaggt
tgtggttcatggggtggtaactctatttctgaaaacgtagggccaagtcaccttatcaat
aaaaaaatggtcgctaagagggctgaaaacatgttgtggcataagcttccttcatctatc
tatttccgtcgcggtagtctacctattgcacttgaagagttaagtgataagaaacgtgcc
cttatcgttacagataaatacctgttcaataacggctactgtgatgagacccttaagatt
cttaaggctcaaggcctagaaacggaagttttctatgaagttgaagccgatcccacctta
gccattgtccagcaaggtgcaaaagtggctcaaagcttccagccagatgtgatcatcgct
cttggtggtggctcaccaatggatgccgccaagataatctgggtactctatgaacaccct
gctgtggactttgccgatctagcgctgcgttttatggatatccgcaaacgtatctacaaa
ttccctaagttgggcgtaaaagcgcagatggtagcgataccaaccacttctggtacgggt
tcagaggtcacgccttttgcggtggtaaccgatgagaaaacaggcatgaaataccctatt
gccgattaccagctcacacccaatatcgccattgtcgatccaaacttagtcatggatatg
cctaagtctcttacagccttcggggggattgatgccgttactcatgcgcttgaagcttat
gtgagtgtgatggccaacgaattcagtgatggtcaagcgctacaagcactcgatctgcta
tttaagtatctacctgactcctacacattaggtgcggcggcccccgttgcgagagagaag
gtacataatggtgcaacgatagcaggtatcgcctttgcaaacgccttcttggggatctgt
cactctatggcccataaacttggcgccgagttccatcttgcccacggccttgccaatgca
ctattaatcagcaatgttatccgctttaatgcgactgacatgcctacgaaacaggcagcc
tttagtcaatacgatcgccctaaagcactatgccgttacgctaaaattgcggaacattta
aacttagctggaaatacagatgaagagaaagtcgaagcactactcgaagcaattgatcaa
ctcaaggcgacgattggcattccggcttcaattcaagaggctggcgtcaacgaagccgac
ttcctcgccaagcttgatgagttagccgaagatgcattcgatgatcaatgtacaggggct
aacccaaggtatccgctcattgctgagctaaaacaggtgctactcgatagtttctacggc
aacaaatacagtgataaatga

DBGET integrated database retrieval system