KEGG   Shewanella woodyi: Swoo_2315Help
Entry
Swoo_2315         CDS       T00676                                 

Definition
orotidine 5'-phosphate decarboxylase (EC:4.1.1.23)
Orthology
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
swd  Shewanella woodyi
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Swoo_2315
Enzymes [BR:swd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     Swoo_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2844015..2844716
Genome map
AA seq 233 aa AA seqDB search
MSNKPILVALDFDDKNAALQLVDKLDPNMCRLKVGKEMFTLFGPQLVKDIHSRGFDLFLD
LKFHDIPNTVAKAVSSAAELGVWMTNIHASGGLAMMEAAKKALVPYGDDAPLLIAVTVLT
SMSDEDLKLIGIDVPAFEHVQRLAKLTQKAGLDGVVCSAHEAEILKASLGDSFKLVTPGI
RPVGADKGDQHRIMTPPQAIAAGSDYLVIGRPITKAADPLAALTAIHQSIQVS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaaaccaattttagtcgccttagattttgatgataaaaacgctgctttgcaa
ttagtcgataagctcgatccaaacatgtgtcgcttaaaagtgggcaaagagatgtttact
ctttttgggccacaactggtcaaagacattcacagtcgtggcttcgatctctttcttgat
ctaaaatttcatgatattccaaacacagtagcgaaagccgtttcatcggcagctgagtta
ggtgtttggatgacaaatattcatgctagtggtggtcttgccatgatggaagcggctaaa
aaagcactcgttccatacggtgacgatgcgccattgcttattgctgttactgtgctgact
tcgatgagtgatgaggatcttaagctgatcgggattgatgtgccagcttttgagcatgtt
caacgacttgctaaattaacgcaaaaagccggcctcgacggtgtggtatgttcagcacat
gaagctgagatattaaaagcctctttgggtgattcatttaagttagtcacaccgggtata
cgtccagttggcgcagataagggtgatcagcacagaattatgacaccgcctcaagcgatt
gcagcaggctctgattacttagtcattgggcgacctattacaaaagctgctgatccactt
gcagcgctaacggcaattcatcaatcgattcaagtgagttaa

DBGET integrated database retrieval system