KEGG   Shewanella woodyi ATCC 51908: Swoo_2315Help
Entry
Swoo_2315         CDS       T00676                                 

Definition
orotidine 5'-phosphate decarboxylase (EC:4.1.1.23)
Orthology
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:swd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2844015..2844716
Genome map
AA seq 233 aa AA seqDB search
MSNKPILVALDFDDKNAALQLVDKLDPNMCRLKVGKEMFTLFGPQLVKDIHSRGFDLFLD
LKFHDIPNTVAKAVSSAAELGVWMTNIHASGGLAMMEAAKKALVPYGDDAPLLIAVTVLT
SMSDEDLKLIGIDVPAFEHVQRLAKLTQKAGLDGVVCSAHEAEILKASLGDSFKLVTPGI
RPVGADKGDQHRIMTPPQAIAAGSDYLVIGRPITKAADPLAALTAIHQSIQVS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaaaccaattttagtcgccttagattttgatgataaaaacgctgctttgcaa
ttagtcgataagctcgatccaaacatgtgtcgcttaaaagtgggcaaagagatgtttact
ctttttgggccacaactggtcaaagacattcacagtcgtggcttcgatctctttcttgat
ctaaaatttcatgatattccaaacacagtagcgaaagccgtttcatcggcagctgagtta
ggtgtttggatgacaaatattcatgctagtggtggtcttgccatgatggaagcggctaaa
aaagcactcgttccatacggtgacgatgcgccattgcttattgctgttactgtgctgact
tcgatgagtgatgaggatcttaagctgatcgggattgatgtgccagcttttgagcatgtt
caacgacttgctaaattaacgcaaaaagccggcctcgacggtgtggtatgttcagcacat
gaagctgagatattaaaagcctctttgggtgattcatttaagttagtcacaccgggtata
cgtccagttggcgcagataagggtgatcagcacagaattatgacaccgcctcaagcgatt
gcagcaggctctgattacttagtcattgggcgacctattacaaaagctgctgatccactt
gcagcgctaacggcaattcatcaatcgattcaagtgagttaa

DBGET integrated database retrieval system