KEGG   Shewanella woodyi: Swoo_2378Help
Entry
Swoo_2378         CDS       T00676                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
swd  Shewanella woodyi
Brite
Enzymes [BR:swd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Swoo_2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DUF1924
Motif
Other DBs
NCBI-ProteinID: ACA86657
UniProt: B1KFB6
Position
complement(2916553..2917593)
Genome map
AA seq 346 aa AA seqDB search
MKTAIACLGLLLSSTLDAIEVEYSDHVFVPGHQSLQYWLLPSPVPTPADNPQTSEKIALG
KMLFFDPRLSGDSNMSCATCHNPMLAWSDSQSVALGYRSQKLTRATPPIINVAYNHLQMW
DGRLRTLEEQALAPMEAQLEMHANLDEKIALLQSIEGYVEAFSLAFPDEAISKQTMAKAI
ASFERTVISDSSNFDAWVKGDKNALTRVEIEGFKLFINPQKGNCSVCHSAPNFTDDGFHN
IGLASFGDKHPDLGRYKQRPLNLMKGAFKTPTLRDVALSAPFFHDGSAATLTQVVKHYSD
GGVVKTNLSPNFKANQLSEDEISAIVAFLNALTSPHEPIQLPKLPQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagccattgcttgtttaggcctactcctctcatctactttagatgccattgaa
gtagagtattctgatcatgtttttgtccctggccatcaaagcttacagtactggctgctt
ccctctcctgttccgacacccgcagataacccacaaacaagtgagaaaatagcactcgga
aaaatgctcttttttgacccaagattgagtggtgacagtaacatgtcctgtgcaacttgc
cataaccccatgttagcttggtctgatagccaaagtgtggcattaggatatagaagccaa
aaattaacacgcgcaaccccaccgattatcaatgttgcctacaatcatctgcagatgtgg
gatggccgactacgtacccttgaagagcaagctctagctcctatggaggcacaacttgag
atgcatgcaaatctcgatgaaaaaatagcacttttgcaaagtattgaaggctatgttgaa
gcatttagccttgcctttcctgatgaagccattagtaaacaaactatggcaaaggcgata
gccagttttgagcgcacagtgatcagtgacagttcaaacttcgatgcttgggtgaaagga
gataaaaatgcactaacaagagttgagattgaagggtttaaactgttcattaatccacaa
aaaggcaactgctctgtctgtcacagtgcgcccaactttactgatgatggatttcataac
atagggctggcttcatttggtgataaacaccccgatctaggtcgatacaagcaaaggcca
ctgaacttaatgaagggcgcctttaaaacgccaactttaagagatgtcgcactctctgcc
cccttctttcatgacggctctgctgcaacattaacccaagtcgttaagcactacagtgac
ggtggtgtagttaaaacgaatctatcccctaatttcaaagcgaatcaactctcagaagat
gagatcagcgctattgttgcttttctaaatgcactcacaagcccacacgaacctatacaa
ctacctaaactgcctcaataa

DBGET integrated database retrieval system