KEGG   Shewanella woodyi: Swoo_2531Help
Entry
Swoo_2531         CDS       T00676                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
swd  Shewanella woodyi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3095138..3096181)
Genome map
AA seq 347 aa AA seqDB search
MNLAKHLSDIEVSAKILRHAVPKMSELDIPVTPDNYSVWYEYFLGVNLDLNRTIDEYISK
GVTFTAEINSELVKNYILEQSPEVIENVHVETQLVINNLLEKVTQMSSGTANLTETLSEF
HQELKQTVDADVLLKLVNTLADEMGSVISDNKQMEASLNTMNEEVSSLKSEMENLSIVAQ
TDQLTSLFNRRAFEKEIESHMIHYKQDHSASCLLVVDIDHFKLFNDTHGHLIGDKVLAYV
ALALKKTVKGTDFVARYGGEEFVVLLPNTELNDALTVAELVRQKIANQKLSIGKEDKHSL
GSITVSVGVSTLHNSDDRESYFIRADEALYRAKSSGRNCICSELAES
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaacttagctaaacatctttctgatattgaggtctctgcaaaaattcttaggcatgct
gtacccaaaatgtctgaactggatattcctgttactccagataactactcagtttggtat
gagtattttttgggggtgaatttagacttaaatcgtaccattgatgaatatatctcaaaa
ggtgtgacttttacggccgagataaacagtgagctggtaaaaaattatattttagagcaa
tctcctgaagtgatagaaaatgtccatgtagagacacaattggtgatcaataacctactg
gaaaaagtcactcagatgagtagtggtactgcaaacctaactgagacattaagtgagttt
catcaagagctcaaacaaactgttgatgccgatgttttattgaagttggtaaatacatta
gccgatgaaatgggaagtgtcattagtgacaataagcagatggaggcaagtctcaatacc
atgaacgaagaggtgagctcgctaaagtctgagatggaaaacctgagtattgtggcgcaa
acggatcagttaacttctctctttaaccgccgtgcgtttgaaaaagagatagaatcgcac
atgatacattacaagcaagatcacagcgcaagctgtttgcttgtggtcgatattgatcat
tttaaactttttaatgatacccatgggcatttaattggtgacaaggtgctcgcctatgtc
gctttagctcttaagaaaacagtcaagggaacggatttcgttgccagatatggtggagaa
gagtttgttgtcttactgcctaatactgagttaaatgatgctttaacggtggcagaactc
gtgcgccagaaaatagcaaatcaaaaactcagcattggcaaggaggataaacactccctt
ggttcaattacggtttctgttggtgtttctaccttgcataattctgatgacagagaaagc
tattttattagagccgatgaggcactttaccgagcgaaatcctctggccgtaactgtatc
tgtagtgagttggctgaatcttag

DBGET integrated database retrieval system