KEGG   Shewanella woodyi: Swoo_2643Help
Entry
Swoo_2643         CDS       T00676                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
swd  Shewanella woodyi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:swd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Swoo_2643
Enzymes [BR:swd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Swoo_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3238529..3240577
Genome map
AA seq 682 aa AA seqDB search
MIQSTQPIKDLLKVWEVERLITPLDRHFALELALVHQQQLTALDKSHSSDNSCTQSLYKE
DSYSELFLLTCALLSKQLSQQHTCLPIKQIVLDNPMVEQVSNCQITCSHDELTSLLAQFA
CIGLVSPESQVEQVAAAATPIVLDCGDLYLQRYYQFETQVSDTLIQLSKEPGSQVSPATK
ASLDILFPAPDDVTVFDWQKIATATAFSKKLAVITGGPGTGKTTTVTKLLFLLTQESPMT
IRLVAPTGKAAARLSESIKASKQRLKLELAPYAHQINLDSLTRVPEEASTLHRLLGVIPN
SHKFRHHKDNPLRLDLLVVDEASMVDLPMMHKVLSALPSHARLILLGDQDQLASVEAGAV
LADICAGLKARSDAQSKWQMRYSAGYAQTLSTLTSFDLSLFTSESPKIGDSLCMLMHSHR
FKGDAGIGQLAAAVNNSDKAGIMQVWQRGYEELLWIEHQKTQSGNTGLDQLLSLAVSHYK
RYLELAKDNTATATDIIDSYNEFRILCAMRAGEYGVDGINLSVTNALKQAKLITTDVEFY
QGRPVIIQSNDYNLGLFNGDIGLILLDNEKSAQNGSVPRLMAHFIQADGSILKVLPARLP
SHDTCFAMTVHKSQGSEFANVGLVLPLWPSLAQKQLLTKELVYTAITRAKQHFTCLGSQT
VFEHASLQATQRSSGLARRLWL
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgatccaatccacacagcccattaaagatctgcttaaagtctgggaagttgagcgttta
atcacgccactagacagacactttgcactggagctcgcactcgttcaccaacaacagctt
accgctctagataagtcgcatagcagtgataactcatgcacacaaagcttgtacaaagag
gactcctacagcgaactctttttactgacctgcgccctgctcagcaaacaactatcacaa
caacacacctgtttgcccatcaaacagatagtgctagataaccctatggtggagcaagtc
tctaactgtcagatcacctgtagccatgatgagttaacctcgcttttagcgcagtttgct
tgtatcggcttggtcagcccagagtcacaggtagaacaagtcgcggcggctgcaaccccg
atagtattagattgcggcgatctctacctgcaacgctattatcaatttgagacccaagtc
agcgacacgctcattcaactatcaaaagagccaggctctcaagtttcaccagccacaaaa
gcaagcttagacatcctctttcctgcacctgatgatgtcactgtatttgactggcaaaaa
atcgctaccgccacggcatttagcaaaaagctggcagttatcaccggcggccctggaaca
ggtaaaaccacaaccgtcactaaactgctatttttgctaacccaagaatcgccaatgacc
attagactggtcgcgccaacaggtaaagcagccgcaaggttaagtgaatctattaaggcg
tccaagcagcgcttgaagctggagctggctccctacgcacaccagattaatctcgatagc
ttaactcgagtccccgaagaggcctctaccctacacagattgttaggggttatccccaat
tcacacaaatttcgccaccataaggacaacccgctcaggctagatctgctggttgtcgat
gaggcctctatggtcgatctgcccatgatgcataaggtgttatcggcactgccaagccac
gccagactgatactgcttggcgatcaagaccagcttgcatcggtcgaggctggcgccgta
cttgctgatatctgtgcgggcttaaaagcccgaagtgatgcacaaagcaagtggcagatg
cgctattcagcaggttatgcacaaacactgtcaacattgaccagctttgatctcagcctc
tttaccagtgaatcaccaaaaattggtgatagtctctgcatgttgatgcacagccacaga
tttaaaggcgatgcaggcattggccaactggccgctgcggtcaataactccgataaagca
ggtatcatgcaggtttggcagaggggttatgaggagctactctggattgagcatcaaaag
acacagtcaggcaacacaggtttagatcaactgctctccctcgccgtgtctcattacaaa
cgctaccttgaactggccaaagataatactgccacagccaccgatatcatcgactcctat
aacgagtttcgcattttatgcgccatgcgcgctggtgaatatggcgtcgatggcatcaac
ttaagtgtcactaatgcactaaaacaggcaaaactcatcaccactgatgtcgagttttac
caaggccgcccagtaataatccaaagtaacgactataacttaggcctgtttaatggtgat
attggcttgatactactagataatgaaaagtctgcgcagaacggatcggtaccaaggctg
atggcccactttatccaagcagatggtagcatcttaaaagtcctcccagcccgtctaccc
agccacgatacctgttttgccatgacagtacacaagagccaaggtagtgaatttgccaac
gtaggcttagtcctgccattgtggcccagccttgctcaaaagcagctgttaaccaaagaa
ctcgtatacacagccatcacccgagccaagcaacacttcacatgcctaggctcacaaacc
gtcttcgagcacgccagtctgcaagccacacagcgctcatcaggacttgctaggcgtttg
tggctatag

DBGET integrated database retrieval system