KEGG   Shewanella woodyi: Swoo_2725Help
Entry
Swoo_2725         CDS       T00676                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
swd  Shewanella woodyi
Pathway
swd00010  Glycolysis / Gluconeogenesis
swd00620  Pyruvate metabolism
swd00640  Propanoate metabolism
swd00680  Methane metabolism
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
swd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swoo_2725
   00620 Pyruvate metabolism
    Swoo_2725
   00640 Propanoate metabolism
    Swoo_2725
  Energy metabolism
   00680 Methane metabolism
    Swoo_2725
Enzymes [BR:swd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Swoo_2725
Lipid biosynthesis proteins [BR:swd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Swoo_2725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACA87001
UniProt: B1KIF0
Position
3338218..3340170
Genome map
AA seq 650 aa AA seqDB search
MSTQSLYKVSSEIAENAHVNEEQYKKMYQESIVNPEGFWREHGQRIDWIKPYTKIKKTSF
DDHNLSINWFYDGTLNASANCLDRHLEKSADKVAIIWEGDDAKDQRTITYGELHKDVCKF
ANALRSQGVRRGDVVTVYMPMVPEAAVVMLACARIGAVHSVVFGGFSPDSIASRVIDGKS
KVVITADEGVRAGRIIPLKANIDEALSHPDVDCVEKVIVYERTGGDVNWVEGRDIKWNAL
MDTASEHCEAEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYVFDYKDGEV
YWCTADVGWITGHSYMVYGPLANGATILIHEGVPNYPTPSRLGEMVDRHKVNILYTAPTL
IRALMAEGKEQFADFDGSSLRIMGSVGEPINPEAWRWYNEVIGHEQCPIVDTWWQTETGG
ILISPLPGATDTKPGSATRPFFGVQPALVDNMGNIIEGATEGNLVMLDSWPGQMRTVFGD
HERFALTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVSHE
SVAEAAVVGYPHDIKGQGIYAYVTLTKGTTETEELRQDLRKWVRKEIGALATPDLIQWAG
GLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPAVIDTLIESRLNRSE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagtctctctacaaagtttcaagcgaaatcgctgaaaacgcacatgtaaat
gaagaacagtataaaaagatgtaccaagagtcgattgtgaatcctgaaggtttctggaga
gagcacggtcaacgtattgattggattaagccatataccaagattaaaaagacctcgttc
gacgatcataatctgtcgattaactggttttatgacggcacgttaaacgcgtcagccaac
tgcttagatcgccaccttgaaaaaagtgctgataaagtcgctatcatctgggaaggcgat
gatgcaaaagatcaacgaacgattacttatggtgagcttcacaaagatgtttgtaagttt
gccaacgcactacgtagccaaggcgtaagacgtggtgatgttgttacagtttatatgcct
atggttcctgaagcggccgtggtgatgcttgcctgtgctcgcatcggtgctgtccactca
gtggtatttggtggtttctcacctgactctatcgcctcacgcgtgattgatggaaaatca
aaagtcgttattacagccgatgaaggtgtgcgtgctggccgtatcattcctctaaaagcc
aatatcgatgaagccttatctcatcctgatgttgattgcgtcgaaaaagttatcgtttat
gagcgcactggcggcgatgtaaactgggtagaaggtcgcgacatcaagtggaatgcgtta
atggataccgcctctgagcactgtgaagctgaggagatgggcgcggaagatccgcttttc
ctactctacacctctggctcaacaggcaatccaaagggcgttttgcatactaccggtggc
tacatggtttatgcagcaatgacccatgaatatgtctttgattacaaagatggtgaggtt
tactggtgtaccgcggatgtcggttggatcactggccactcctatatggtgtatggtcca
ttggcaaatggagcaacaatccttattcatgaaggcgtacctaattaccctaccccatct
cgccttggtgaaatggttgatcgccacaaagtgaacattctctacactgcaccaacatta
attcgtgcccttatggcggaaggcaaggagcagtttgctgactttgacggcagttctctg
cgtattatgggttccgttggtgagccaataaatccagaggcatggcgctggtataacgaa
gtcatcggccatgagcagtgccctattgtcgatacttggtggcaaacagaaacgggcggt
atcttaattagcccactccctggtgctactgacacaaaacctggctcagcgactcgtcct
ttcttcggcgtgcaacctgcgcttgtcgataacatgggtaacatcatcgaaggcgccact
gaaggtaacttggtgatgcttgattcatggcctggacagatgagaaccgtgtttggcgat
catgagcgttttgcactaacttacttcaagacattccgcggcatgtacttcaccggtgat
ggcgcaagacgtgatgaagatggctactactggatcacgggtcgtgttgatgacgtcatt
aacgtttcaggtcacagacttggaactgctgaagttgaaagcgcattagtatctcatgag
agcgtcgctgaagcggctgtggttggctatcctcatgatattaagggccaaggtatctat
gcctatgtcaccttaaccaagggaacgacagagactgaggagttacgtcaagatctccga
aagtgggtacgtaaagagattggtgctttagcaacgccagatcttatccagtgggcgggt
ggtctaccaaaaactcgctctggaaaaattatgcgccgcttcctacgtaagatagctgcc
aatgaagtgactaacttaggcgattcatcgacactggcagatcctgctgttatcgataca
ctaattgaatctcgcttaaaccgtagcgagtaa

DBGET integrated database retrieval system