KEGG   Shewanella woodyi: Swoo_2898Help
Entry
Swoo_2898         CDS       T00676                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
swd  Shewanella woodyi
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Swoo_2898
Enzymes [BR:swd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Swoo_2898
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Swoo_2898
Lipid biosynthesis proteins [BR:swd01004]
 Fatty acid synthase
  Component type
   Swoo_2898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3543114..3543686
Genome map
AA seq 190 aa AA seqDB search
MSLAAILSCSQVIAAPILILGDSLSASYGVDEDQGWVNLMRKKMPQHEIVNGSVSGETTA
GGLRRLPALLDSVKPELVLVELGGNDGLRGFTPQQLKENLTKIITLTKAQGSQLLLSEIM
VPPNYGPRYAKMFNQVYADLAAEHQITLMPFFMTKIAINPDFMQRDGIHPNASAQNDIAE
FVVPWIEKAL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagcggccattctatcttgttctcaagtgattgctgcacctatattaatccta
ggtgatagcctaagtgcaagttatggagtcgatgaagatcaaggttgggttaacttaatg
cgcaagaagatgccacaacatgagatagtcaacggctctgtcagtggtgaaacaactgcg
ggaggattgcgtagactccccgccctgcttgactccgtaaagcctgagctggttctggtt
gaactcggtggtaacgatggactaagaggatttaccccacaacaactgaaagaaaatctt
acaaaaataattaccttaaccaaggctcaagggagtcaactactcctttcagagataatg
gttccgccaaattacggtccacgatatgccaagatgttcaatcaggtctatgcagactta
gccgcagagcaccaaataaccctaatgccattttttatgacaaaaatagccatcaatcca
gactttatgcaaagagacggtattcaccccaatgcatcggcgcaaaatgatatcgccgag
tttgtcgtaccttggattgaaaaagcattatag

DBGET integrated database retrieval system