KEGG   Shewanella woodyi ATCC 51908: Swoo_2898Help
Entry
Swoo_2898         CDS       T00676                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:swd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3543114..3543686
Genome map
AA seq 190 aa AA seqDB search
MSLAAILSCSQVIAAPILILGDSLSASYGVDEDQGWVNLMRKKMPQHEIVNGSVSGETTA
GGLRRLPALLDSVKPELVLVELGGNDGLRGFTPQQLKENLTKIITLTKAQGSQLLLSEIM
VPPNYGPRYAKMFNQVYADLAAEHQITLMPFFMTKIAINPDFMQRDGIHPNASAQNDIAE
FVVPWIEKAL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagcggccattctatcttgttctcaagtgattgctgcacctatattaatccta
ggtgatagcctaagtgcaagttatggagtcgatgaagatcaaggttgggttaacttaatg
cgcaagaagatgccacaacatgagatagtcaacggctctgtcagtggtgaaacaactgcg
ggaggattgcgtagactccccgccctgcttgactccgtaaagcctgagctggttctggtt
gaactcggtggtaacgatggactaagaggatttaccccacaacaactgaaagaaaatctt
acaaaaataattaccttaaccaaggctcaagggagtcaactactcctttcagagataatg
gttccgccaaattacggtccacgatatgccaagatgttcaatcaggtctatgcagactta
gccgcagagcaccaaataaccctaatgccattttttatgacaaaaatagccatcaatcca
gactttatgcaaagagacggtattcaccccaatgcatcggcgcaaaatgatatcgccgag
tttgtcgtaccttggattgaaaaagcattatag

DBGET integrated database retrieval system