KEGG   Shewanella woodyi ATCC 51908: Swoo_2916Help
Entry
Swoo_2916         CDS       T00676                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:swd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:swd00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:swd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3565360..3566583
Genome map
AA seq 407 aa AA seqDB search
MTKLDPYFGEYGGMYVPQILMPALKQLETAFVEAQEDEAFKTEFNDLLKNYAGRPTALTL
TRNLSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCKVYMGAKDVERQSPNVFRMKLMGAEVIPVTSGSSTLKDACNEAMRDWSGSY
DKAHYLLGTAAGPHPFPTIVREFQRMIGAETKKQILEREGRLPDAVIACVGGGSNAIGMF
ADFIDEESVKLIGVEPAGLGIDTPMHGAPLKHGKTGIFFGMKAPLMQDREGQIEESYSIS
AGLDFPSVGPQHAHLAATGRATYESATDDEALEAFQLLARSEGIIPALESAHALAYAVKM
AKAATQETILVVNLSGRGDKDIFTVADILEERERSQTGQQKEESGND
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgactaagctcgacccctatttcggcgaatatggcggcatgtatgtgcctcaaatttta
atgccagcactcaagcaacttgaaacagcatttgttgaagctcaggaagatgaagcattt
aaaactgaatttaacgatctgctaaaaaattacgctggccgtcctacagcgctcacctta
actcgtaatttaagtcctaaccctttagtgaaaatttacctaaagcgtgaagatctcctt
catggtggcgctcacaaaacaaaccaagtattaggtcaagctctgcttgcaaagcgtatg
ggtaagaaagagatcatcgccgaaactggtgctggtcaacatggagttgcaaccgctctt
gcttgtgcgcttcttgacttaaaatgtaaggtttacatgggcgcaaaagatgttgagcgc
caatcgcctaatgtgttcagaatgaagctgatgggtgctgaagtgatcccagtaacatca
ggctcctccaccctaaaagatgcctgtaatgaggcgatgcgcgactggtcaggtagctat
gataaggcccattatctactgggaaccgcagcaggaccacaccctttcccgacgattgtt
cgcgaatttcagagaatgattggtgctgaaacgaagaagcagattctagagcgcgagggt
cgtctacctgatgcggttatcgcctgcgtcggcggtggttctaatgccatcggcatgttt
gccgactttattgatgaagagtctgtcaaattaattggtgttgaacctgcaggtttaggt
attgataccccaatgcacggcgcgccacttaagcatggtaaaaccggaatattcttcggt
atgaaagccccattgatgcaagatagggagggacaaattgaggagtcctactcaatctca
gcaggcctcgacttcccatcagtgggtccacaacatgcccatttggctgccacaggccgt
gcaacctatgagtcggccaccgatgatgaagcattagaagcgttccagctactagcacga
agtgaggggatcatccctgcattagagtctgcccatgcactcgcttacgccgtcaaaatg
gcaaaagccgcaacacaggagaccatattggtggtgaacttatcgggtcgaggcgataaa
gatatctttaccgttgctgatattttagaggagcgcgagaggtcacaaacgggccagcaa
aaagaggagagtggcaatgactga

DBGET integrated database retrieval system