KEGG   Shewanella woodyi: Swoo_2917Help
Entry
Swoo_2917         CDS       T00676                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
swd  Shewanella woodyi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Swoo_2917
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swoo_2917
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swoo_2917
Enzymes [BR:swd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Swoo_2917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3566576..3567394
Genome map
AA seq 272 aa AA seqDB search
MTESKQAGRYQAAFAKLEAKNQGAFVPFVTLGDPSPEISLKIIDCLVENGADALELGFPF
SDPLADGPVIQGANLRSLAAGTTPSQCFEMLSTIRAKYPELPIGLLLYANLVYANGIENF
YAKAQAAGVDSVLIADVPVEEAEPFITSAKAHGVAPIFIAPPNADSDTLKLVSEKGEGYT
YLLSRAGVTGTESKAGMPIDDILARLKEFNAAPPLLGFGIAEPAQVREAIQAGAAGAISG
SAVVKIIEANKDNETELLTKLGEFTRNMKAAT
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctaaacaagcaggccgttatcaggcagcctttgccaaacttgaggcaaaa
aaccagggggcatttgttccttttgtcaccttaggcgaccctagccccgaaatatcttta
aaaattatcgactgtttagttgaaaatggcgccgatgcgttagagttaggctttcctttc
tcagacccattagccgatggcccggttattcaaggagccaacctacgctctcttgctgct
ggcaccacaccaagtcaatgctttgagatgctcagtacaattcgcgctaagtacccagag
ttacccatagggttgcttctgtacgcaaacttggtctatgccaatggtatcgaaaatttt
tatgcgaaagctcaagcggcaggtgttgattcagtgttgattgccgatgtacctgttgaa
gaggctgaacctttcatcacgtcagctaaagcccatggagtggcaccaatctttatcgct
ccgcccaacgcagacagtgacacattaaagctggtcagtgaaaaaggtgaaggatatacc
taccttctctcccgtgcaggagtgacgggcacagagtctaaagctggtatgccgattgac
gatattctcgctaggctaaaggagtttaacgcagccccgcccttgcttgggttcggtatt
gccgagcccgctcaagtgagagaagcgattcaagctggcgcagctggcgccatatcaggc
tctgcggtggtaaaaatcatcgaagcaaacaaagataatgaaacagagcttctcactaag
ttaggtgaatttacccgtaatatgaaggctgctacttag

DBGET integrated database retrieval system