KEGG   Shewanella woodyi: Swoo_3548Help
Entry
Swoo_3548         CDS       T00676                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
swd  Shewanella woodyi
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Swoo_3548 (deoA)
Enzymes [BR:swd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Swoo_3548 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4330739..4332070)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNAEALSKEEIQFFVKGITDNTVSEGQIAALGMAVYFNDMNMDERIALT
TSMRDSGTVLDWQSLDLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPDSALFRKVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLAAGLDALAMDVKVGSGAFMPTYEASEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGRYRNPRLYEVTMGLCAEMLMLGGIASTETQAREKL
NAVLDNGKAAEIFGRMISGLGGPTDFVENPGLYLPESKIIRPVYAEQTGFATSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDEISKDKPIAMIHAQTETAFAEAERAVRKA
IHIGDSRPEKTPEIYRYIRASDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagcacaagagataattcgtaaaaagcgcaacgctgaagccttatcgaaggag
gagatccagttcttcgttaaaggcatcacagataatacagtttcagaaggtcaaatcgca
gcccttggcatggcggtttacttcaacgatatgaacatggatgagcgcattgcgttgaca
acctccatgcgtgactctggcacagtactagactggcagagcctagatcttaatggtcct
attatagataagcacagcaccggtggtgttggtgatgtgataagcctgatgcttggtcct
atggctgcggcctgtggcggttatgttcctatgatctcaggtcgtggacttggccacact
ggcggcacattagataagtttgatgccattcctggctaccaaactgagccagatagtgcc
cttttcagaaaagtcgttaaagaggctggtgttgccattattggccagactggcgatctc
gttcctgccgataaacgtttctactccattcgcgataacacagcgactgtagagtcaatc
tcccttattaccgcttcaattctttctaagaagttggccgcaggtcttgatgcgttagct
atggatgtcaaagtgggcagtggcgcatttatgcctacctatgaagcctcagaggagctt
gctcgtagtattactgctgtggctaacggcgctgggactaaaaccactgcgctactcact
gatatgaaccaagtgcttgcatcttgtgcaggtaacgcggtagaagtgaaagaggcgatt
gacttcctaacgggtagataccgtaatccacgcctctatgaagtaaccatggggctttgc
gccgagatgttgatgttaggtggcattgcctctactgaaacccaggcccgtgagaagctc
aatgcagtacttgataatggtaaagcggcagagatctttggccgcatgatctctggttta
ggtggtccgacagattttgttgaaaacccaggtctatacctaccagagtctaagattatt
cgtcctgtctatgctgagcaaacaggttttgctacatcgatggacacccgtgaacttggt
cttgccgttgttaccttaggtggtggacgtcgtaagccaggtgatgcgctcgattacagt
gttggtttgacgcaagtgtgcgctttaggcgatgaaatatcgaaagataagcccattgcc
atgatccatgctcagactgaaacagcatttgcagaagctgaaagagccgtgagaaaagcg
atccatattggtgattctcgtcctgagaaaacgcctgaaatttatcgttatatccgcgct
agcgatctgtaa

DBGET integrated database retrieval system