KEGG   Shewanella woodyi ATCC 51908: Swoo_3565Help
Entry
Swoo_3565         CDS       T00676                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:swd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:swd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:swd00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:swd00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:swd00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4352459..4353241)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLAQELFKKFATKLQNDSAEVVLCPPTIYLESVRQQLDANKE
ALNGCLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNSTEFLSLCSIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtccaatggtcgctggtaactggaaaatgaatggcagtgcacagctt
gcacaagagctattcaaaaagttcgctaccaaacttcaaaatgattctgcggaagtggtc
ttgtgtccgccaacgatttatctagagagcgtacgtcagcagttagacgctaacaaggaa
gccttaaatggttgtcttgtcagaatgggcgcacaaaaccttagtcaacatgattttggt
gcttatactggtgaagtgtcagggcagatgttaaaagattcaggatgtcgatatgttatt
atcggacactccgaacgtcgccgtatgtacggagagacgagtgatatcgttgcagagaag
tttgctgcagcacaaaaacatggtttgaccccaatattatgtgttggtgagtccggtcca
gctagagaagcgagacgtacctttgaggtgatcgcagaagagttagatgtcgtcattgag
aaaaatggcaccatggcttttgataacgcaattatcgcctacgaacctttatgggcagta
ggaacaggtaagagtgctacgccagagcaggctcaagaagttcatgcgtttattcgcaag
cgcctctctgaagtgtctccatttattggagagaatatcaggattttgtacggtggcagc
gtaacaccgagtaatgcagcagatttatttgctcaacctgatgtcgatggtggattgatt
ggcggagtgagcttaaactctaccgagtttctaagtttatgttccatagcgatgagcgca
taa

DBGET integrated database retrieval system