KEGG   Shewanella woodyi: Swoo_3565Help
Entry
Swoo_3565         CDS       T00676                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
swd  Shewanella woodyi
Pathway
swd00010  Glycolysis / Gluconeogenesis
swd00051  Fructose and mannose metabolism
swd00562  Inositol phosphate metabolism
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd01130  Biosynthesis of antibiotics
swd01200  Carbon metabolism
swd01230  Biosynthesis of amino acids
Module
swd_M00002  Glycolysis, core module involving three-carbon compounds
swd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swoo_3565
   00051 Fructose and mannose metabolism
    Swoo_3565
   00562 Inositol phosphate metabolism
    Swoo_3565
Enzymes [BR:swd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Swoo_3565
Exosome [BR:swd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Swoo_3565
  Exosomal proteins of bladder cancer cells
   Swoo_3565
  Exosomal proteins of melanoma cells
   Swoo_3565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACA87829
UniProt: B1KRR4
Position
complement(4352459..4353241)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLAQELFKKFATKLQNDSAEVVLCPPTIYLESVRQQLDANKE
ALNGCLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNSTEFLSLCSIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtccaatggtcgctggtaactggaaaatgaatggcagtgcacagctt
gcacaagagctattcaaaaagttcgctaccaaacttcaaaatgattctgcggaagtggtc
ttgtgtccgccaacgatttatctagagagcgtacgtcagcagttagacgctaacaaggaa
gccttaaatggttgtcttgtcagaatgggcgcacaaaaccttagtcaacatgattttggt
gcttatactggtgaagtgtcagggcagatgttaaaagattcaggatgtcgatatgttatt
atcggacactccgaacgtcgccgtatgtacggagagacgagtgatatcgttgcagagaag
tttgctgcagcacaaaaacatggtttgaccccaatattatgtgttggtgagtccggtcca
gctagagaagcgagacgtacctttgaggtgatcgcagaagagttagatgtcgtcattgag
aaaaatggcaccatggcttttgataacgcaattatcgcctacgaacctttatgggcagta
ggaacaggtaagagtgctacgccagagcaggctcaagaagttcatgcgtttattcgcaag
cgcctctctgaagtgtctccatttattggagagaatatcaggattttgtacggtggcagc
gtaacaccgagtaatgcagcagatttatttgctcaacctgatgtcgatggtggattgatt
ggcggagtgagcttaaactctaccgagtttctaagtttatgttccatagcgatgagcgca
taa

DBGET integrated database retrieval system