KEGG   Shewanella woodyi: Swoo_3801Help
Entry
Swoo_3801         CDS       T00676                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
swd  Shewanella woodyi
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Swoo_3801
Enzymes [BR:swd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Swoo_3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4641045..4641545
Genome map
AA seq 166 aa AA seqDB search
MAKVFVALGANLTDPVAQLDSASMALSELAEVNPTNGLTSLTLSPYYRSAPMGEVEQPDY
VNAVACFDTSLSPIDLLDALQKIENEQERVRLERWGPRTLDLDILLYDDQIIDSPRLTIP
HYGMKQRSFVLIPLEDIAPNTILPCGTELKGLIDAKLRAQLEQIVR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggtttttgtggcgctaggcgccaacctaacagatcctgtcgctcagctagat
agtgcctctatggcactatctgagttagctgaagttaaccctacaaacgggttaacttca
ctaacactctccccttattaccgctcagcacctatgggtgaagtagaacaaccagactat
gtgaacgccgttgcatgtttcgacacaagcctctcccctattgacctactcgatgcactg
caaaagatagagaatgaacaggagcgggtaaggttagagcggtggggaccacgcacctta
gatctcgatatcttactttatgacgatcagatcatagactctcctaggttaacaatccct
cactatggcatgaaacagcgtagctttgtgttaatccccttagaagatatagcaccgaac
acaatacttccctgtggaacagagctcaaagggcttatagatgctaaattacgcgcacaa
ttagaacaaatagtcagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system