KEGG   Shewanella woodyi ATCC 51908: Swoo_4538Help
Entry
Swoo_4538         CDS       T00676                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:swd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:swd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5502894..5504402)
Genome map
AA seq 502 aa AA seqDB search
MLLKDLLAPWFHYSGSESVNKLSLDSREVDQGDLFVAVPGHQVDGRDYIDVAAKNGAQVS
LVHTDNPEMHGKVLTSNSTQIFFFQLSRQLSALAAQAYPLPVERLKLVGVTGTNGKTSIT
QLMAQLLVCLGKQPAVMGTLGNGLWGGLVDSGNTTADPITIMAQLNAFNELGADLCAMEV
SSHGLIQARVDAVPFDLAIFTNLSRDHLDYHGTMQAYGEAKFRLFKFPSLKSGVINLDDD
LGKQWLAQSDSAKLIGYSIAGDSDTVSQDAAIYTKGNHFHNQGVRAKLVWPEGCGNIDSP
LLGAFNLSNLLAALAGLYQLGFDMNALLNAVPKLNAVAGRMEQFTTENGITLVVDYAHTP
DAIEQALKALRGHCEGELWCLFGCGGDRDKGKRPLMAQSAEAYADRIMVTSDNARSESPD
EIINDVLAGLNRPERAVTQVDRELAIREVLAAAKPGDLILLAGKGHETYQEAGGVRRDYD
ERALARSLASGSLANNSSEVDR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctactaaaagatctattagcaccttggttccattactcaggatctgagagtgttaac
aagttgagccttgatagccgtgaggtagaccaaggcgatctgtttgttgctgtgcctggt
catcaagttgatggtcgagattacattgatgtggcggcaaaaaatggtgcacaagtgtca
ctggtgcatactgacaaccccgagatgcacggtaaggttttgactagcaacagcacccag
atttttttctttcagctaagccgtcagctctctgctttggctgctcaggcctatccactg
cctgttgagcgtttgaaattagttggtgtcacaggcacaaatggtaaaacttctattacg
cagcttatggcgcaactgttagtttgtttaggcaaacagcctgctgtgatgggaacctta
ggtaatggactttggggagggttagtcgacagtggtaatacaaccgccgaccctattacc
atcatggctcaacttaacgcttttaatgagctgggtgcagatctgtgtgcaatggaagta
tcaagccatggcctgatacaggcaagagtcgatgcggtccccttcgacttggctattttt
actaatttaagccgagatcatcttgattatcatggcactatgcaggcctatggtgaggct
aagttcaggttatttaagttcccctctctaaagtcaggcgttatcaaccttgatgatgat
ttaggtaagcagtggttggctcaaagtgattcagccaagctgattggttatagcattgct
ggcgatagtgacactgtttctcaagatgcagctatttataccaaaggtaaccattttcat
aatcaaggtgtcagagcaaagcttgtatggcccgaaggctgcggcaatattgactcccct
ctgctaggtgcatttaacctgtcaaacttgcttgcagctttagcgggcctttatcaactt
ggttttgatatgaatgccctgcttaatgccgtgccaaagctgaatgccgttgctggacga
atggagcagtttactactgaaaacggtatcacacttgtggtggattatgcccatactccc
gatgctattgaacaggcacttaaggcgctaagaggtcactgtgagggtgagctgtggtgt
ctatttggttgtggcggcgatcgtgataaaggcaagcgtcctttaatggcgcagtctgct
gaagcgtatgccgaccgtattatggtgaccagtgataatgctagaagcgagtctccagat
gagataattaatgacgtattggcagggcttaatcgccctgaacgtgcggttacacaagtg
gatcgtgaactggcgattagagaggtgctagccgccgctaaacctggcgaccttattttg
ctggcaggtaaggggcatgaaacctatcaagaggccggtggtgtgcgacgtgattatgat
gaacgtgcattagctcgcagtttagcaagtggaagtttagctaataatagttctgaggta
gatagatga

DBGET integrated database retrieval system