KEGG   Shewanella woodyi: Swoo_4544Help
Entry
Swoo_4544         CDS       T00676                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
swd  Shewanella woodyi
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Swoo_4544
Enzymes [BR:swd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Swoo_4544
Exosome [BR:swd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Swoo_4544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5508932..5510419)
Genome map
AA seq 495 aa AA seqDB search
MTKKYVVALDQGTTSSRAIIFDHDANIVSVSQREFTQIYPQAGWVEHDPMEIWASQSSTL
IEVIARSGIHASEIASIGITNQRETTVIWDKQTGKPVYNAIVWQCRRSSEICEELKSQGL
EAYIRDTTGLLLDPYFSGTKIKWILDNVSGVRERAERGELLFGTIDTWLVWKLTEGKVHV
TDPTNASRTLLFNIHTQSWDKRILEALTIPESLLPQVKPSSAVYGKTRIAGEGGEISIAG
IAGDQQSALFGQLCTEPGMAKNTYGTGCFLLMNTGEKAVKSNHGLLTTIAIGAKGEVNYA
LEGSVFMGGATIQWLRDELGLIRDAQDTEYFASRVESTNGVYLVPAFVGLGAPYWDPSAR
GALVGLTRGSNRNHIIRAALEAIAYQSRDLLDAMAKDSGVELKKLKVDGGAVANDFLMQF
QADITSVEVQRPAVTETTAMGAAFLAGLAVGFWDSTSELKHRADIDKSFMPSISEEQKDE
LYAGWQKAVSQTING
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaaaaatatgttgtggcactggaccaaggaactaccagttccagagcgattatt
ttcgatcatgatgcgaatattgtgtcggtttcacagcgtgagtttactcaaatttatccc
caagcgggttgggttgaacatgatcctatggagatatgggcatcccagagttccacttta
atagaggtcatagcacgaagtgggatccatgccagtgagatcgcatcgattgggatcacc
aatcaacgtgagacaacggttatctgggataagcaaactggcaagccagtttataacgcc
attgtttggcagtgcagacgcagcagtgagatctgtgaggagcttaaatctcaaggatta
gaggcgtatattcgagatactacaggcctactcttagacccttacttttctggcacgaaa
attaaatggattttagacaatgtttcgggcgtgagggagcgggctgaaagaggtgagctg
ctatttggcaccatagatacttggcttgtatggaagctgactgaaggtaaagttcatgtt
accgatcccaccaatgccagtcgtactttattgttcaatatccatacccaaagctgggat
aagagaatacttgaagcattaactatccctgaatctcttcttcctcaagtgaaaccctct
agtgccgtctatggtaaaacgcgtatcgcaggcgaaggaggagagatctccattgctggg
attgctggcgatcagcaatctgcgctctttggtcagctatgtactgagccggggatggca
aagaatacctatggtactggctgttttcttctgatgaatacaggagagaaagcagtaaag
tcgaatcatggtctactgacaaccatagcaattggtgccaagggagaggtgaactatgct
ctggagggctcagtatttatgggaggtgcgacgattcaatggctaagagatgagcttgga
ttaatcagagatgctcaggatactgagtattttgcctcaagagtcgagagtacaaatggc
gtatatctggtaccagccttcgttggtttaggagcgccctattgggatcctagtgccaga
ggggcattagtagggctgacccgaggttcaaatcgaaaccacattattcgagcggcactg
gaagctatagcctatcagagcagagatctgctcgatgcaatggctaaagacagtggtgtg
gagctaaagaaacttaaagtcgatggtggcgcagttgccaatgactttttgatgcagttt
caagccgatataacttcggttgaggtgcagcgaccagctgttacagaaactacggctatg
ggagctgcgtttcttgcaggtctagctgtgggattctgggactctacctcagagcttaag
cacagggccgatatcgacaaatcttttatgccatctatcagtgaagagcaaaaagatgag
ttatatgcaggctggcaaaaggctgtctcacaaacgattaatggataa

DBGET integrated database retrieval system