KEGG   Shewanella woodyi ATCC 51908: Swoo_4721Help
Entry
Swoo_4721         CDS       T00676                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
swd  Shewanella woodyi ATCC 51908
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:swd01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:swd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5699523..5700488
Genome map
AA seq 321 aa AA seqDB search
MLNTDRVYSNDKHSAFSGTVKWKPVKSIWFLTHLLATILIAPFVLSFSAFFVFLILTAIT
LCFGHSLGMHRLLIHRSYECPKWMEYLFVYLGVLVGMAGPIGMMIQHDLRDWAQRQTQCH
DYLLHGSKILKDGWWQLNCDLVLNNPPEFNIEESVSLNKFYQFIEKTWMLQQLVLAIPLF
LIGGIPWLVWGVSVRIVISVGGHWLIGYFAHNKGDKTWEVEGAAVQGHNIKVAGFLSMGE
AWHNNHHAYPGSAMLGLYSDEPDPGWWVLNALHNLRIVKNIKLPKQLPARSELVKVSDNI
DSRVERVPEDCEVAKFIRKGS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatacggatagagtttattcaaatgataaacatagtgcttttagtggcactgta
aaatggaagcctgttaaatctatttggtttttgactcatctcttagcaactattttaatt
gctccatttgttttgtctttttccgccttttttgtctttttaatccttacagctattaca
ttatgttttgggcattcgctaggaatgcatagattgctaattcatcgctcatatgaatgt
cctaaatggatggagtatttgtttgtatatttgggtgtgttagttggaatggcaggccca
ataggcatgatgattcaacatgaccttcgtgattgggcgcaaagacaaactcagtgtcat
gattacttattacatggctcaaaaatactaaaggatggttggtggcaattaaattgtgat
cttgtactaaacaaccctcccgaatttaatatagaagaatcggtatccttaaataagttt
tatcaattcatagaaaaaacgtggatgcttcaacaattagtcctagccattcctttattt
cttattggtggtataccttggttagtttggggcgtttctgttcgaattgtaatatctgtc
ggtggtcattggctcattggttactttgcccataataaaggcgataaaacttgggaagtt
gaaggagctgcggtacaaggccacaatattaaagtagcgggtttcctttcaatgggagaa
gcgtggcataacaatcatcatgcttatccgggttccgcaatgttaggcttgtacagtgac
gaaccagatccagggtggtgggttctaaacgctttacataatctaagaatcgttaaaaac
attaaattgccaaagcagctaccagctaggtcagaattagtcaaagtttctgataatatt
gacagtcgagttgaacgagtgcctgaggactgcgaagtcgcaaagtttatacgaaaaggc
agctaa

DBGET integrated database retrieval system