KEGG   Sphingomonas wittichii: Swit_0404Help
Entry
Swit_0404         CDS       T00538                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
swi  Sphingomonas wittichii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
429538..430674
Genome map
AA seq 378 aa AA seqDB search
MYEGKPPSSAGRKGWSFDALFGRSAVDDSAAVPAAQVPVPAGPDDAPPTDLFGRIGGFLR
THRLDPSPINYDLAYQYIGGHDPALVASVDAAIARDGLLRHDVAQEIAEAASSRVSSDLL
GKLIDQAHRSVTLAAALVGQSRTDARAYGSALDRGSAAIEAGGEPAGRALELMAELTRTM
IDKTNDAERRLVEMGSQMSSLQGELAEAQAVAESDPLTGLANRRAFQARLARAMAQAAAE
GTPLSVAFCDIDHFKSINDNHGHDTGDRILKMVAEALVEGVGEDAFVGRFGGEEFLILFD
GIMARRAAMRVDEVRDELSGRHLVSKTTGEPLGTVTFSAGVAQLLVGEDDGAMLRRADEA
LYAAKNGGRNRVIIHGEE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaggaaagccgccatcctccgccggccgcaagggctggagcttcgatgcgctg
ttcggccgctcggccgtagacgactccgccgccgtcccggccgcgcaggtgcccgtcccg
gccggcccggacgatgccccgccgaccgatctgttcggccggatcggcggcttcctgcgc
acccaccggctcgatccgagcccgatcaactatgacctggcctatcagtatatcggcggc
catgatccggcgctggtcgcctcggtcgatgccgcgatcgcgcgcgacggcctgctgcgc
cacgacgtcgcccaggagatcgccgaggcggcgtcgagccgggtgtcgtccgacctgctc
ggcaagctgatcgaccaggcgcaccgcagcgtcaccctggccgccgcgctggtcgggcag
tcgcgcaccgatgccagggcctatggcagcgcgctcgaccgcggttcggcggcgatcgag
gccggcggcgaaccggcgggccgcgcgctcgaactgatggccgagctgacccgcacgatg
atcgacaagaccaacgacgccgagcgccgcctggtcgagatgggcagccagatgagcagc
ctgcagggcgaactggccgaggcccaggcggtggccgagagcgacccgctgaccggtctc
gccaaccgccgggccttccaggctcgcctcgcgcgggcgatggcgcaggcggcggcggaa
ggcacgccgctgtcggttgccttctgcgacatcgatcatttcaagtcgatcaacgacaat
cacggccatgacaccggcgaccggatattgaagatggtggccgaggcgctggtcgagggc
gtcggcgaggacgcgttcgtcggccgcttcggcggcgaggaattcctcatcctgttcgat
ggcatcatggcgcgccgcgcggcgatgcgtgtcgacgaggttcgcgacgaactgtcgggc
cgccacctcgtctccaagaccaccggcgaaccgctcggcaccgtcaccttctcggccggc
gtcgcccaactgttggtgggcgaggacgacggcgcgatgctccgccgcgccgacgaagcg
ctctacgcggcgaagaatggcggccgcaaccgggtgatcatccacggcgaggaatag

DBGET integrated database retrieval system