KEGG   Sphingomonas wittichii: Swit_0484Help
Entry
Swit_0484         CDS       T00538                                 

Definition
thymidylate kinase (EC:2.7.4.9)
Orthology
K00943  
dTMP kinase [EC:2.7.4.9]
Organism
swi  Sphingomonas wittichii
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:swi00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
519095..519721
Genome map
AA seq 208 aa AA seqDB search
MPGRFITLEGGEGVGKSTQAKALAAALRARGLDVVETREPGGSDGAEAIRRLLLEGAADR
WNARAEALLFAAARADHVARTIRPAIEAGRWVVCDRFLDSSIAYQGGADGLGDEAIRTLH
AIGSAGYLPDRTLLLDMPVFDAAFRQAEAGIANSDRFEKRDEAFHDRVADSFRRIAAQEP
ARIRTINAQGSPQEVTARLIEALADLLP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggtagattcatcaccctggaaggcggggagggggtcggcaagtcgacccaggcc
aaggcgctggccgccgcgttgcgcgcgcgcgggctcgacgtggtcgagacgcgcgaaccg
ggcggcagcgacggcgccgaggcgatccgccgcctgctgctcgaaggcgccgccgaccgc
tggaacgcgcgcgccgaggcgctgctgttcgccgccgcgcgcgccgaccatgtcgcgcgg
acgatccggcccgcgatcgaggccggacgctgggtggtgtgcgatcgcttcctcgacagc
tcgatcgcctatcagggcggcgccgacgggctcggcgacgaggcgatccggacgctgcac
gcgatcggcagcgccggctacctgcccgatcgcaccctgctgctcgacatgccggtgttc
gacgcggccttccgtcaggccgaggccgggatcgccaacagcgatcggttcgagaagcgc
gacgaggccttccacgaccgggtcgcggacagcttccgcaggatcgcggcgcaggaaccg
gcgcgaatccgcacgatcaacgcgcaagggtcgccgcaggaggtgaccgcgcggctgatc
gaggcgctggcggacctgttgccatga

DBGET integrated database retrieval system