KEGG   Sphingomonas wittichii: Swit_0669Help
Entry
Swit_0669         CDS       T00538                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
swi  Sphingomonas wittichii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swit_0669
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swit_0669
   00620 Pyruvate metabolism
    Swit_0669
   00640 Propanoate metabolism
    Swit_0669
  Energy metabolism
   00680 Methane metabolism
    Swit_0669
Enzymes [BR:swi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Swit_0669
Lipid biosynthesis proteins [BR:swi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Swit_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
725817..727499
Genome map
AA seq 560 aa AA seqDB search
MLLNGDRLQAARDFLIRHRTDHDAAVAGFAWPRFEQFNFAFDWFDRIAERSDAIALSIAS
PRGLRAWSYRDLSLGSNRVAHFLRRHGIGPGDRLLIALGNRIELWETQLAAMKAGCVMVP
CTVMLGAAELRERMARSGARAIVADDSIAERLGTPDKGWIGFNVDAPRPGWIDYGAAYGE
PAGFAPDQPTRGTDPLLIYFTSGTTAQPKMVTHSHVSYPVGHLSTLYWIGLKPGDTHLNI
SSPGWAKHAWSSFYAPWLAEASILTIDQPAFDARFVLDQIRDRAVDCFCAPPTVWRMLLQ
ERIEQWPVRLREAVSAGEPLNPHVVERVREVWGIDVRDGYGQTETTAQIGNTPGQPLVAG
AMGRPLPGFRIELDGAADHGEIILHAGDMAAGVMLGLQAEAGSAVLPPSGGIHRTGDIAS
AAPDGTLTYIGRADDVFKSSDYRISPFEIESVLLEHPAVAESAVIPSPEPTRLAVPKAII
VLAPGHAPSAETAAEIFAHSRARLAPYKRIRRLEFGELPKTVSGKTRRAELREREDGGRS
EGEYREEDFATTAKSGSRSG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgctattgaacggagacaggttgcaggccgcgcgggactttctcatccggcatcgcacc
gatcatgacgccgcggtagccggcttcgcctggccgcgcttcgagcagttcaacttcgcc
ttcgactggttcgatcggatcgccgagcgcagcgatgcgatcgcgctgtcgatcgccagc
ccccgaggcctccgtgcctggtcctaccgcgacctgtccctcggctcgaaccgtgtcgcg
catttcctgcgccgccatgggatcggccccggcgatcgactgctgatcgcgctcggcaac
cggatcgaactctgggaaacgcagctcgccgcgatgaaggccggctgcgtgatggtgccc
tgcacggtgatgctgggggcagccgaactgcgcgagcgcatggcccgcagcggcgcgcgc
gcaatcgtcgccgacgacagcatagccgaacgcctgggcacgcccgataagggctggatc
ggcttcaacgtcgacgccccccgccccggctggatcgattatggcgcggcttatggcgag
ccggccggcttcgcgccggatcagccgacacgcggcaccgatccgctgctgatctacttc
acctccggcaccacggcgcagccgaagatggtgacgcacagccatgtttcctatccggtc
ggccatctgtcgacgctctactggatcgggctgaaacccggcgatacgcatctcaacatc
tcgtcgcctggctgggccaaacatgcctggagcagtttctacgcgccctggctcgccgag
gcatcgatcctgacgatcgaccagcccgccttcgacgcgcgcttcgtgctcgatcaaatc
cgcgatcgcgcggtggactgtttctgcgcgccgccgacggtgtggcgcatgctgctgcag
gagaggatcgagcaatggcccgtccgcctgcgcgaagcggtcagcgccggcgaaccgctg
aacccgcatgtggtggagcgcgtccgcgaagtctggggtatcgacgtgcgcgacggctat
ggccaaaccgagacgaccgcccagatcggcaatacgccgggccagccgctggtcgccggc
gcgatgggccgtccgctgcccggcttccgcatcgaactcgacggcgccgccgaccatggc
gagatcatcctgcacgccggggacatggccgcgggggtgatgctcgggctgcaggccgaa
gccggcagcgcggtcctgccgccatctggcggtatccaccggaccggcgacatcgcctcc
gccgcaccggacggcacgctgacctatatcggccgcgccgacgatgtcttcaaatcgagc
gactacaggatcagccccttcgaaatcgagagcgtcctgctggaacatccggcagtagcc
gaatccgccgtcatccccagccccgagccaacccgcctggcggtgcccaaggcgatcatc
gtcctggcgccgggccatgccccctcggccgaaaccgccgcggagattttcgcacacagt
cgcgcccgcctggcgccctataagcggatcaggcgactggaattcggcgagctgccgaag
acggtttcgggcaagacgcgtcgcgccgaattgcgcgagcgagaagatggcggccggtcc
gagggcgaatatcgggaggaggatttcgccactacagcgaagagcgggtctcgatcaggt
tga

DBGET integrated database retrieval system