KEGG   Sphingomonas wittichii: Swit_0761Help
Entry
Swit_0761         CDS       T00538                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
swi  Sphingomonas wittichii
Pathway
swi00020  Citrate cycle (TCA cycle)
swi00310  Lysine degradation
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01200  Carbon metabolism
Module
swi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
swi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Swit_0761
  Amino acid metabolism
   00310 Lysine degradation
    Swit_0761
Enzymes [BR:swi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Swit_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABQ67128
JGI: Swit0761
UniProt: A5V4B2
Position
complement(840668..841930)
Genome map
AA seq 420 aa AA seqDB search
MGYIDIFVPAEQEGTKAIVRSWLRNVGDRVEENDPLVELETDKVTQEVPAPAAGVIAEIL
LASDAEAEPGALLGRLRVGDEAAAGATPPAASGDAGAEPGEAGFAPAPASSPAPAAPGDK
SMALALSPAVRRAVRTHDIDPATITGTGKAGRITRADVDKAVAERAAAPAPRPAPAPVAA
REEAPASAGGVRSIPHDRMRLAIAQNMLNSVTVAPHVTAMFECDFTAIMAHRRKHKAAFA
AEGANLTFTAYFIAACVAAMKAAPAINSRWHDDRLDIFDDVNIGIGTALGDKGLVVPVVS
KCQELSLLGIAKRLTEMVERARANKLTPADMRGGTFTISNHGVSGSLFATPIIINQPQSA
ILGIGKTEKRVVVREVDGVDTIQIRSLAYVSLTIDHRVVDGHQTNGWLSAFVETLENWPS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgggatatatcgatattttcgtgcccgccgagcaggagggcaccaaggcgatcgtgcgg
agctggctccgcaatgtcggcgaccgggtcgaggagaatgatccgctggtcgagctggag
acggacaaggtcacccaggaagtgcccgcgccggccgccggcgtgatcgccgagatactg
ttggcatccgacgcggaggccgagcctggcgctttgctcggccgcctgagggtcggtgac
gaggcggcggcgggcgcgacgcccccggccgcttccggggatgccggagccgagcctggg
gaggcggggttcgccccggctccggcatcttccccggcgccggccgcgccgggcgacaag
agcatggcgctggcgctgtcccctgcggtgcgccgcgccgtgcggacgcacgacatcgat
ccggcgacgatcaccggcaccggcaaggcggggcggatcacccgcgccgacgtcgacaag
gcggtcgccgagcgcgccgccgcgccggctcccaggcccgcgccggcccctgtcgcggcg
cgcgaggaggctccggcgtcggcaggcggcgtgcggtcgatcccgcacgaccggatgcgc
ctggcgatcgcccagaacatgctcaacagcgtgacggtcgctccgcacgtcacggcgatg
ttcgaatgcgacttcaccgcgatcatggcgcatcgccgcaagcacaaggcggcgttcgcg
gcggagggcgcgaacctgaccttcaccgcctatttcatcgcggcctgcgtcgcggcgatg
aaggcggcgccggcgatcaacagccgctggcacgacgaccggctcgacatcttcgacgac
gtcaacatcggcatcggcaccgcgctgggcgacaaggggctggtcgtcccggtcgtctcg
aaatgccaggagctgtcgctgctcggcatcgccaagcggctgaccgagatggtcgagcgc
gcccgcgccaacaagctgaccccggccgacatgcgtggcggcaccttcaccatctccaac
catggcgtgtcgggatcgctgttcgccacgccgatcatcatcaaccagccgcagtcggcg
atcctcggcatcggcaagaccgagaagcgggtggtggtgcgcgaggtcgacggcgtcgac
acgatccagatccggtcgctcgcctatgtctccctgacgatcgaccatcgcgtggtcgac
gggcaccagaccaacggctggctctcggccttcgtcgagacgctcgaaaactggccgtcg
tga

DBGET integrated database retrieval system