KEGG   Sphingomonas wittichii: Swit_1051Help
Entry
Swit_1051         CDS       T00538                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
swi  Sphingomonas wittichii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:swi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:swi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1171761..1172717
Genome map
AA seq 318 aa AA seqDB search
MEKRRIALVGAPVALGASRPGCAMGPEAMRIAGLAEALAELGHEVSDHGDVAPMRADDVS
LEGHARHAAHIAGWARALDEAAYGLLKDGRLPIFMGGDHALAMGTVSGAARHAHEQGRPL
CVLWLDAHADFNTPTTSESGNMHGMPVAFYCGEAGFEGILPAGRPTVAPRNVFMVGIRSV
DARERELIAARGVRVFDMRAIDEFGVAAIVRRILAEVERIGAMLHVSLDVDFLDPTIAPG
VGTAVGGGANLREAHLIMEMLCESGLTSSMDIAELNPYLDERGRSARLLADLAASLFGRQ
VLDKVSTLATVKGLQNAA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcgaaggatcgcgttggtgggcgcgccggtcgccctgggcgcgagccggccc
ggctgcgcgatggggcccgaggcgatgcgcatcgccggcctggcggaggcgctcgccgag
ctcggccatgaggtgtcggaccatggcgatgtcgccccgatgcgcgcggacgacgtctcg
ctcgaaggccatgcccgccatgccgcccatatcgctggctgggcgcgggcgctcgacgag
gccgcctatggcctgctgaaggacggacggctgccgatcttcatgggcggcgaccatgcg
ctcgcgatgggcaccgtctcgggcgcggcgcgccacgcccacgaacaggggcggccgctc
tgcgtgctctggctcgacgcccatgccgacttcaacacgccgacgacgtcggagtcgggc
aacatgcacgggatgccggtggccttctactgcggcgaggcggggttcgaaggcatcctg
cccgccggccgccccaccgtggcgccgcgcaacgtcttcatggtcggcatccgatcggtg
gatgcgcgcgagcgcgagctgatcgccgcgcgcggcgtccgggtgttcgacatgcgcgcg
atcgacgagttcggcgtcgccgcgatcgtccggcgcatcctggccgaggtcgagcggatc
ggcgcgatgctgcacgtcagcctcgacgtcgatttcctcgatcccacgatcgcccccggc
gtcggcaccgcggtcggcggcggcgccaatctgcgcgaggcgcatctgatcatggagatg
ctctgcgaatccggcctgaccagctcgatggatatcgccgagctcaacccatatctcgac
gagcgcggccgcagcgcccgcctgctcgccgatctcgccgccagcctgttcggccggcag
gtcctcgacaaggtctcgacgctcgccaccgtgaaaggattgcagaatgccgcttaa

DBGET integrated database retrieval system