KEGG   Sphingomonas wittichii: Swit_1199Help
Entry
Swit_1199         CDS       T00538                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
swi  Sphingomonas wittichii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Swit_1199
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Swit_1199
Enzymes [BR:swi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Swit_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1359521..1360069
Genome map
AA seq 182 aa AA seqDB search
MATDIQQIPLKTIGGADATLGDYAGKVLLAVNVASKCGLTPQYTALEALYGQYKDKGFAV
LGFPANNFGAQEPGTESEIQEFCTTNYGVDFPMFAKLSVKGDDQHPLYAKLVAAQPDKTF
KDGSFKEKLAGYGIVPEKDTDVLWNFEKFLIAKDGTVAGRFAPDIAPDDPIITGAIEAEL
AK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgatatccagcagattccgctcaagacgatcggcggcgccgacgccaccctc
ggcgactatgccggcaaggtgctgctggcggtcaacgtcgcgtcgaaatgcggcctgacc
ccgcaatataccgcgctcgaggcgctgtacggccagtacaaggacaagggcttcgccgta
ctcggcttccccgccaataatttcggcgcgcaggagcccggcaccgagagcgagatccag
gaattctgcacgaccaactacggcgtcgacttcccgatgttcgccaagctctcggtcaag
ggcgacgaccagcatccgctctacgccaagctcgtcgcggcgcagcccgacaagaccttc
aaggacggcagcttcaaggagaagctggccggctacggcatcgtgccggagaaggacacc
gacgtgctgtggaacttcgagaagttcctgatcgccaaggacggcaccgtcgccggccgc
ttcgcgcccgacatcgcccccgacgatcccatcatcaccggcgcgatcgaggccgaactg
gccaagtaa

DBGET integrated database retrieval system