KEGG   Sphingomonas wittichii: Swit_1311Help
Entry
Swit_1311         CDS       T00538                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
swi  Sphingomonas wittichii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Swit_1311
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Swit_1311
   00650 Butanoate metabolism
    Swit_1311
  Energy metabolism
   00190 Oxidative phosphorylation
    Swit_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1467936..1468325)
Genome map
AA seq 129 aa AA seqDB search
MGNGTGIGRVRGLGSAKHGAMHWWRQRVTAAGNLLLATWFVVSLFRLPNLGHDVVVQWIG
SPIVAVPLVLLTVSVFYHMRLGLQVVLEDYVHEDAGKVFSLLLLNLYTIAGAALAIFSIL
KIAFGGVSA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacggaaccggaatcggccgcgtccgcggcctcggctcggccaagcatggcgcg
atgcactggtggcgccagcgggtgacggcggcgggcaacctgctgctcgccacctggttc
gtcgtctcgctgttccgcctgcccaacctcgggcacgacgtggtggtgcagtggatcggc
tcgccgatcgtggcggtgccgctggtcctgctgaccgtctcggtcttctaccacatgcgg
ctgggcctccaggtcgtcctcgaggactatgtccatgaggatgccggcaaggtcttctcc
ctgctgctgctcaacctctacacgatcgcaggcgccgcgctggcgatcttctcgatcctc
aagatcgccttcgggggagtttcggcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system